DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RYBP and rybpb

Sequence 1:NP_001286742.1 Gene:RYBP FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001012373.1 Gene:rybpb ZFINID:ZDB-GENE-061103-96 Length:257 Species:Danio rerio

Alignment Length:235 Identity:80/236 (34%)
Similarity:101/236 (43%) Gaps:95/236 (40%)


  Fly     1 MDKKSSPVRRQKRQAKVIEEN-FWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQA 64
            |..|.||. |.|||||...:| ||||||||:|||||||||.:|||||||||||||:||.|||||.
Zfish     1 MGDKKSPT-RPKRQAKPTADNGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQV 64

  Fly    65 A---------------------------------------------------------------- 65
            |                                                                
Zfish    65 AQQYATPPPPKKEKKEKPERPEKDRAEEERPDINPPDEHPVEQRDKDKSEKEQPEKEKKDREKEI 129

  Fly    66 -----TLPGASVNMP----------------NGKSASGSRHGSGHDRQRHKRYPARLKNVDRSTA 109
                 ..|.:..|.|                :|||.:.:::.       |...| :|||:|||||
Zfish   130 IPAITKKPNSKKNRPKSDIHQSPPSERNSIQSGKSTTKTKNS-------HNSRP-KLKNIDRSTA 186

  Fly   110 QTREVTVNSVTVFITEYKAKPVSSRRESSEQSFSESNDSR 149
            |...:||.:|||.||::|.|..:|...||..:.|.|::.:
Zfish   187 QQLAITVGNVTVIITDFKEKTRTSSTSSSTVTSSASSEQQ 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 19/24 (79%)
RanBP2-type Zn finger 23..42 CDD:275377 16/19 (84%)
rybpbNP_001012373.1 ZnF_RBZ 21..43 CDD:197784 18/22 (82%)
RanBP2-type Zn finger 23..42 CDD:275377 16/19 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4477
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4337
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1634090at2759
OrthoFinder 1 1.000 FOG0002361
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12920
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5806
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.