DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and Litaf

DIOPT Version :10

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_064364.1 Gene:Litaf / 56722 MGIID:1929512 Length:161 Species:Mus musculus


Alignment Length:123 Identity:36/123 - (29%)
Similarity:53/123 - (43%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PQAPGFQAPPSYDSAPQQVYPQLHQGQGVILQGENTENYESIGNNAPPNVLGQCPSVATCPSCGV 76
            |...|.. ||||.:.|            |.:...|....:::....|.:...: |....||||..
Mouse    51 PDGKGMN-PPSYYTQP------------VPVPNANAIAVQTVYVQQPVSFYDR-PVQMCCPSCSK 101

  Fly    77 RRETKVEFEPSTKTHLLALLICMLGGIC-CCCIPYCTDSCQSAKHTCTSCGAYVGTYK 133
            ...|::.:.....|.|....:|:||.:. ||.||:|.|:.|...|.|.:|.|.:||||
Mouse   102 MIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:463165 24/67 (36%)
LitafNP_064364.1 PPxY motif 20..23
zf-LITAF-like 89..159 CDD:463165 24/70 (34%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 111..134 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.