DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and DIT2

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_010690.1 Gene:DIT2 SGDID:S000002810 Length:489 Species:Saccharomyces cerevisiae

Alignment Length:490 Identity:110/491 (22%)
Similarity:190/491 (39%) Gaps:99/491 (20%)


  Fly    56 LADIYARHEGKIVG---IYMLNKRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDPLSA---- 113
            |.|:|.|...:..|   .:..::.:||:..::...||. .|..:|...|   ::.|.|.||    
Yeast    54 LYDLYIRESMEKYGAVKFFFGSRWNILVSRSEYLAQIF-KDEDTFAKSG---NQKKIPYSALAAY 114

  Fly   114 ---NLFNLRGASWRNLRQKLT---------PSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDE 166
               |:.:..||.|||.|..:|         |.|.:.||   ..|:  :.::|   |||    ...
Yeast   115 TGDNVISAYGAVWRNYRNAVTNGLQHFDDAPIFKNAKI---LCTL--IKNRL---LEG----QTS 167

  Fly   167 VEIKDVMTTYAVDIIGSVIFGLEIDSFRNPKNEFREISSSTSRDESLLLKIHNM---SMFICPPI 228
            :.:..:....|:|.|..|..|.:..:..:.||.|.|          .|::|...   ..|:..|.
Yeast   168 IPMGPLSQRMALDNISQVALGFDFGALTHEKNAFHE----------HLIRIKKQIFHPFFLTFPF 222

  Fly   229 AKLMNRLGYESRILTSLRDMMKRTIEFREEHNVVRKDMLQLLIR-----LRNTGKIGEDDDQVWD 288
            ..::.        :.|.:...|..:.|||           ||::     |.|..|..:......|
Yeast   223 LDVLP--------IPSRKKAFKDVVSFRE-----------LLVKRVQDELVNNYKFEQTTFAASD 268

  Fly   289 METAQEQLKSMSIEKIAAQAFLFYVAGSESTAAASAFTLYELSMYP-ELLKEAQEEVDAVLMKHN 352
            :..|... :.:..:::.....:..|||.|:.......:||.|:.|. |..::.::||:.:     
Yeast   269 LIRAHNN-EIIDYKQLTDNIVIILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGI----- 327

  Fly   353 LKPKDRFTYEAVQDLKFLDICIMETIRKYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGM 417
            ..||      .:.||..|:..:.|.:|.||.|..:...||......|...:|.||..:..:.||.
Yeast   328 TDPK------GLADLPLLNAFLFEVVRMYPPLSTIINRCTTKTCKLGAEIVIPKGVYVGYNNFGT 386

  Fly   418 QRDP-VYFPNPNGYDPHRFDSN--------NMNYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAK 473
            ..|| .:....:.:.|.|:.|:        .|..::.|...|..|.|.|:..::.....::::|:
Yeast   387 SHDPKTWGTTADDFKPERWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAE 451

  Fly   474 ILANFDLVQSPRKEVEFRFDAAPVLVTKEPLKLRL 508
            :|..|.....|..| |....|.|:.    ||.|:|
Yeast   452 MLKQFRWSLDPEWE-EKLTPAGPLC----PLNLKL 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 104/478 (22%)
DIT2NP_010690.1 CypX 23..483 CDD:225035 110/491 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.