DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and CYP86C4

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_172774.1 Gene:CYP86C4 AraportID:AT1G13150 Length:529 Species:Arabidopsis thaliana

Alignment Length:457 Identity:105/458 (23%)
Similarity:192/458 (42%) Gaps:70/458 (15%)


  Fly    89 IMTSDFASFHDRGVYVDEDKDPLSANLFNLRGASWRNLRQ-KLTPSFSSGKIKGMFGTIDD-VGD 151
            ::.::|.:|.....:.....|.|...:||....||:..|: .:|...|:|.::..|.|... |..
plant    97 MLKTNFKNFPKGTFFKSRFNDLLEEGIFNADDDSWKEQRRIIITEMHSTGFVEHSFQTTQHLVRK 161

  Fly   152 KLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVIFG-----LEIDSFRNP-KNEFREISSSTSRD 210
            ||::.:|......:..:::||......|||.....|     |.:|..:.| ...|.|.:.||   
plant   162 KLLKVMESFAKSQEAFDLQDVFLRLTFDIICLAGLGADPETLAVDLPQVPFAKAFEEATEST--- 223

  Fly   211 ESLLLKIHNMSMFICPP-IAKLMNRL--GYES--RILTSL------RDMMKRTIEFREEHNV-VR 263
                     :..|:.|| |.|.|..|  |||.  ||...:      :.::.|..|.:||..: .|
plant   224 ---------LFRFMIPPFIWKPMRFLDTGYEKGLRIAVGVVHGFVDKMIVDRICELKEEETLDNR 279

  Fly   264 KDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMSIEKIAAQAFLFYVAGSESTAAASAFTLY 328
            .|:|..:|::.:..:..|.|..              :|.........|.:||.::::.|.::..:
plant   280 SDVLSRIIQIESHKRENEIDPS--------------TIRFFRQFCTSFILAGRDTSSVALSWFCW 330

  Fly   329 ELSMYPELLKEAQEEVDAVLMKHNLKPKDR----FTYEAVQDLKFLDICIMETIRKYPGLPFLNR 389
            .:..:||:..:...|:..:|.:....|..:    ||.:.:.::.:|...:.||:|.:|.:|...:
plant   331 VIQKHPEVENKIICEIREILRQRGDSPTSKNESLFTVKELNNMVYLQAALSETLRLFPPIPMEMK 395

  Fly   390 ECTEDYPVP-GTNHIIAKGTPILISLFGMQR-DPVYFPNPNGYDPHRF--DSNNMNYDQAAYMPF 450
            :..||..:| ||  .:.||:.:..|::.|.| :.::..:...:.|.|:  ....::.||..|:.|
plant   396 QAIEDDVLPDGT--FVRKGSRVYFSIYAMGRMESIWGKDCEIFRPERWIQAGKFVSDDQFKYVVF 458

  Fly   451 GEGPRHCIALRMGKVNSKVAVAKILANF------DLVQSPRKEVEFRFDAAPVLVTKEPLKLRLT 509
            ..|||.||......:..|:..|.:|..:      |.|.:||....        |..|..||:.:|
plant   459 NAGPRLCIGKTFAYLQMKMIAASVLLRYSIKVVQDHVIAPRVTTN--------LYMKYGLKVTIT 515

  Fly   510 KR 511
            .|
plant   516 PR 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 103/451 (23%)
CYP86C4NP_172774.1 PLN03195 30..518 CDD:215627 105/458 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.