DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and CYP94B1

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001331365.1 Gene:CYP94B1 AraportID:AT5G63450 Length:568 Species:Arabidopsis thaliana

Alignment Length:474 Identity:92/475 (19%)
Similarity:193/475 (41%) Gaps:81/475 (17%)


  Fly    72 MLNKRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDPLSANLFNLRGASWRNLRQKLTPSFSS 136
            :..:|:|:..:.:....|:.::|.:|.....:.|...|.|...:||..|..|.:.|:..:..|:.
plant   136 LFGRRTIITANPENVEHILKTNFYNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTM 200

  Fly   137 GKIKGMFGTI--DDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVIFGLEID--SFRNPK 197
            ..::.....|  ::|.::|:..|..|:|..:.|:.::|:..:|.|::..|..|.:.|  ....|.
plant   201 RSLREFTFEILREEVQNRLIPVLSSAVDCGETVDFQEVLKRFAFDVVCKVSLGWDPDCLDLTRPV 265

  Fly   198 NEF-------REISSSTSRDESLLLKIHNMSMFICPPIAKLMNRLGYESRILTSLRDMMKRTIEF 255
            .|.       .|||:..:.:          .::....:.:.:| :|.|.|:              
plant   266 PELVKAFDVAAEISARRATE----------PVYAVWKVKRFLN-VGSEKRL-------------- 305

  Fly   256 REEHNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMET-------AQEQLKSMSIEKIAAQAFLFYV 313
            ||....|...:.:::...:.:..||.|.....|:.:       .:|.::...|.        |.:
plant   306 REAIKTVHLSVSEIIRAKKKSLDIGGDVSDKQDLLSRFLAAGHGEEAVRDSVIS--------FIM 362

  Fly   314 AGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDR--FTYEAVQDLKFLDICIME 376
            ||.::|:||..:..:.||.        .::|:..:: ..|:.|..  ..:|.::::.:...|:.|
plant   363 AGRDTTSAAMTWLFWLLSQ--------NDDVETKIL-DELRNKGSLGLGFEDLREMSYTKACLCE 418

  Fly   377 TIRKYPGLPFLNRECTEDYPVP-GTNHIIAKGTPILISLFGMQR-DPVYFPNPNGYDPHRFDSNN 439
            .:|.||.:.:.::....|..:| ||.  :.||..:....:||.| :.|:..:.:.:.|:|:....
plant   419 AMRLYPPVAWDSKHAANDDILPDGTP--LKKGDKVTYFPYGMGRMEKVWGKDWDEFKPNRWFEEE 481

  Fly   440 MNY---------DQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSPRKEVEFRFDAA 495
            .:|         ....:..|..|||.||...|.....|..|..:|:.|.::........|    .
plant   482 PSYGTKPVLKSVSSFKFPVFQAGPRVCIGKEMAFTQMKYVVGSVLSRFKIIPVCNNRPVF----V 542

  Fly   496 PVLVTKEP--LKLRLTKRK 512
            |:|.....  ||:::.:|:
plant   543 PLLTAHMAGGLKVKIKRRE 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 91/467 (19%)
CYP94B1NP_001331365.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.