DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and CYP735A1

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_198661.1 Gene:CYP735A1 AraportID:AT5G38450 Length:518 Species:Arabidopsis thaliana

Alignment Length:558 Identity:121/559 (22%)
Similarity:220/559 (39%) Gaps:120/559 (21%)


  Fly     4 ILLTIL----------IAGLLYRYVKRHYTHWQRL-------GV-DEEPAKIPFGVMDTVMKQER 50
            :|||||          |..:||..:..::...:|:       || ..:|..:...:::......:
plant     1 MLLTILKSLLVIFVTTILRVLYDTISCYWLTPRRIKKIMEQQGVTGPKPRPLTGNILEISAMVSQ 65

  Fly    51 SLGMALADIYARHEGKIVGIYM-----LNKRSIL---------IRDAQLARQIM-----TSDFAS 96
            |.......|:....|:::..|:     ..||.|:         :.:.:|.::::     .|..:.
plant    66 SASKDCDSIHHDIVGRLLPHYVAWSKQYGKRFIVWNGTDPRLCLTETELIKELLMKHNGVSGRSW 130

  Fly    97 FHDRGVYVDEDKDPLSANLFNLRGASWRNLRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHL---- 157
            ...:|.     |:.:...|....|..|.:.|....|:|:..::||....:.:...|||:.|    
plant   131 LQQQGT-----KNFIGRGLLMANGQDWHHQRHLAAPAFTGERLKGYARHMVECTSKLVERLRKEV 190

  Fly   158 -EGALDQSDEVEIKDVMTTYAVDIIGSVIFGLEIDSFRNPKNEFREISSSTSRDESLLLKIHNMS 221
             |||    :||||.:.|.....|||....||   .||...|..|..::       .|..:....:
plant   191 GEGA----NEVEIGEEMHKLTADIISRTKFG---SSFEKGKELFNHLT-------VLQRRCAQAT 241

  Fly   222 MFICPPIAKLMNRLGYESRILTSLRDMMKRTIEFREEHNVVRKDMLQLLIRL----RNTGKIGED 282
            ..:|.|          .||.|.|         ::..|...::|::.:|||.:    |:..::|..
plant   242 RHLCFP----------GSRFLPS---------KYNREIKSLKKEVERLLIEIIQSRRDCAEMGRS 287

  Fly   283 ----DDQVWDMETAQEQLKSMSIEK-----------IAAQAFLFYVAGSESTAAASAFTLYELSM 332
                ||.:..:      |..|.|:|           |..:...|:.||.|:||....:|...|:.
plant   288 STHGDDLLGLL------LNEMDIDKNNNNNNNNLQLIMDECKTFFFAGHETTALLLTWTTMLLAD 346

  Fly   333 YPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDICIMETIRKYPGLPFLNRECTEDYPV 397
            .|...::.:|||..|..::.|...|:     :..|..|...|.|::|.||....|.|...||..:
plant   347 NPTWQEKVREEVREVFGRNGLPSVDQ-----LSKLTSLSKVINESLRLYPPATLLPRMAFEDLKL 406

  Fly   398 PGTNHIIAKGTPILISLFGMQR-DPVYFPNPNGYDPHRFDSNNMNYDQAAYMPFGEGPRHCIALR 461
            ....  |.||..|.|.:..:.. :.::..:.|.::|.||........: .::||..|||:||..:
plant   407 GDLT--IPKGLSIWIPVLAIHHSEELWGKDANQFNPERFGGRPFASGR-HFIPFAAGPRNCIGQQ 468

  Fly   462 MGKVNSKVAVAKILANFDLVQSPRKEVEFRFDAAPVLV 499
            ...:.:|:.:|.:::.|:..      :...:..||::|
plant   469 FALMEAKIILATLISKFNFT------ISKNYRHAPIVV 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 107/480 (22%)
CYP735A1NP_198661.1 PLN02290 1..518 CDD:215164 121/559 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.