DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and CYP72A8

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_188080.1 Gene:CYP72A8 AraportID:AT3G14620 Length:515 Species:Arabidopsis thaliana

Alignment Length:506 Identity:118/507 (23%)
Similarity:215/507 (42%) Gaps:92/507 (18%)


  Fly    19 KRHYTHWQRLGVDEEPAKIPFGVMD-----TVMKQERSLGMALADIY-----------ARHEGKI 67
            |::..:.:|.|:...|  ..|.|.|     ::::||:|..:.|.|.|           .:..||.
plant    37 KKNEAYLKRQGLSGTP--FTFLVGDIKREASMVEQEKSRPINLTDDYTHRVMPLIQQTVKDHGKT 99

  Fly    68 VGIYMLNKRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDPLS--ANLFN-----LRGASWRN 125
            ..::|....|:::...:..:.::..         || |..|.|:.  ..||.     ..|..|..
plant   100 SYMWMGPIASVIVTKPEHIKDVLNR---------VY-DFPKPPVHPIVELFATGVALYEGEKWSK 154

  Fly   126 LRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQ---SDEVEIKDVMTTYAVDIIGSVIFG 187
            .|:.:.|||...|:|.|.....:...:::...|..:.:   |:|:::...:.....|:|....||
plant   155 HRKIINPSFHLEKLKIMIPAFYESCSEMISKWEKLVTEQGSSNEIDVWPYLGDLTSDVISRTAFG 219

  Fly   188 LEIDSFRNPKNEFREISSSTSRDESLLLKIHNMS----MFICPPIAKL-MNRLGYESRILTSLRD 247
               .|:...|..| |:.....|   .:||...::    |...|....| |.::..|  :.:.||:
plant   220 ---SSYEEGKRIF-ELQEEQGR---RVLKALELAFIPGMRFLPTKNNLRMRQINKE--VKSRLRE 275

  Fly   248 MMKRTIEFREEHNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMSIEKIAAQAFLFY 312
            ::.:.....:.....:.|:|.:|:. .|:|..|                  ||||.:..:..||:
plant   276 IIMKRQRGMDTGEAPKNDLLGILLE-SNSGDHG------------------MSIEDVVEECRLFH 321

  Fly   313 VAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDICIMET 377
            .||.|:||....:|:..||.:.:...:|:||:..|:.|:| ||    .::|:..||.:.:.:.|.
plant   322 FAGQETTAVLLVWTMIMLSHHQKWQDQAREEILKVIGKNN-KP----NFDALSRLKTMSMILNEV 381

  Fly   378 IRKYPGLPFLNR------ECTEDYPVPGTNHIIAKGTPILISLFGMQRDP-VYFPNPNGYDPHRF 435
            :|.||....|.|      :..||..:||       |..::|.:..:.||| ::..:.:.::|.||
plant   382 LRLYPPGILLGRTVEKETKLGEDMTLPG-------GAQVVIPVLMVHRDPELWGEDVHEFNPERF 439

  Fly   436 DS--NNMNYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSP 484
            ..  :....:|.:::|||.|||.|.......:.:|:|:..||..|....||
plant   440 ADGISKATKNQVSFLPFGWGPRFCPGQNFALMEAKMALVLILQRFSFELSP 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 105/445 (24%)
CYP72A8NP_188080.1 p450 26..515 CDD:299894 118/507 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.