DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and CYP3A43

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_073731.1 Gene:CYP3A43 HGNCID:17450 Length:504 Species:Homo sapiens

Alignment Length:529 Identity:141/530 (27%)
Similarity:259/530 (49%) Gaps:62/530 (12%)


  Fly     2 WTILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADIYARHEGK 66
            |.::.|.|:  |||.|....:..:::||:   |...|...:.|::...|.|.....:...:: |:
Human    12 WVLVATSLV--LLYIYGTHSHKLFKKLGI---PGPTPLPFLGTILFYLRGLWNFDRECNEKY-GE 70

  Fly    67 IVGIYMLNKRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDPLSANLFNLRGA-------SWR 124
            :.|:|...:..::|.|..:.:.::..:..|       |..::.||....| |:.|       .|:
Human    71 MWGLYEGQQPMLVIMDPDMIKTVLVKECYS-------VFTNQMPLGPMGF-LKSALSFAEDEEWK 127

  Fly   125 NLRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVIFGLE 189
            .:|..|:|:|:|.|.|.|...|...||.||:.|....:.|..:.:||....|.:|:|...:||:.
Human   128 RIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYTMDVITGTLFGVN 192

  Fly   190 IDSFRNPKNEF----REISSSTSRDESLLLKIHNMSMF-ICPPIAKLMNRLGYESRILT-----S 244
            :||..||::.|    :::......|..|||    :|:| ...|:.:.:| :|...:.:|     |
Human   193 LDSLNNPQDPFLKNMKKLLKLDFLDPFLLL----ISLFPFLTPVFEALN-IGLFPKDVTHFLKNS 252

  Fly   245 LRDMMKRTIEFREEHNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMSIEKIAAQAF 309
            :..|.:..::.:::|.|   |..|.:|..:|:            .||...  |::|..::.||:.
Human   253 IERMKESRLKDKQKHRV---DFFQQMIDSQNS------------KETKSH--KALSDLELVAQSI 300

  Fly   310 LFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDICI 374
            :...|..::|:....|.:|||:.:|::.::.|||:||||..     |...||:|:..:::||:.:
Human   301 IIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPN-----KAPVTYDALVQMEYLDMVV 360

  Fly   375 METIRKYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGMQRDPVYFPNPNGYDPH-RFDSN 438
            .||:|.:|.:..:.|.|.:|..:.|.  .|.||..:::.::.:..||.|:..|..:.|. ||...
Human   361 NETLRLFPVVSRVTRVCKKDIEINGV--FIPKGLAVMVPIYALHHDPKYWTEPEKFCPESRFSKK 423

  Fly   439 NM-NYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSPRKEVEFRFDAAPVLVTKE 502
            |. :.|...|:|||.|||:||.:|....|.|:||.:.|.||........::..:.|..|:|..::
Human   424 NKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEK 488

  Fly   503 PLKLRLTKR 511
            |:.|::..|
Human   489 PIVLKVHLR 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 125/460 (27%)
CYP3A43NP_073731.1 p450 39..494 CDD:278495 131/493 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.