DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and cyp3c4

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001071016.1 Gene:cyp3c4 ZFINID:ZDB-GENE-060929-96 Length:507 Species:Danio rerio

Alignment Length:523 Identity:134/524 (26%)
Similarity:260/524 (50%) Gaps:45/524 (9%)


  Fly     2 WTILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADI-YARHEG 65
            ||  |.:|:..||:.|....:..:.:||:   |...|:..:.|::...:  |:...|: .|:..|
Zfish    11 WT--LVVLVITLLFIYGVWPHRFFIKLGI---PGPRPWPFVGTLLSYAK--GLCNFDMECAKKYG 68

  Fly    66 KIVGIYMLNKRSILIRDAQLARQIMTSD-FASFHDRGVYVDEDKDPLSANLFNLRGASWRNLRQK 129
            |:.|||......:::.|.::.:.::..: :::|.:|.........|.|..:..::...|:.:|..
Zfish    69 KVWGIYDGRLPILMVADLEVIKVVLVKECYSNFINRRKRTTGLAGPFSDGIIMVKDERWKRMRST 133

  Fly   130 LTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVIFGLEIDSFR 194
            |:|.|:||::|.:|.......|:.::::: ..|....|:||:|:..|::|:|.|..|.::|||..
Zfish   134 LSPYFTSGRLKEIFPIAMTHADRFIKNMQ-KKDPEQPVKIKEVVAPYSLDVITSSSFSVDIDSIN 197

  Fly   195 NPKNEF----REISSSTSRDESLLLKIHNMSMFICPPIAKLMNRLG---YESRILTSLRDMMKRT 252
            ||::.|    ::.......:..|||      :.:.|.:|..:.::|   :....:.....::|: 
Zfish   198 NPEDPFVINVKKFIQFNMFNPLLLL------ILLFPSLAIPLKKMGVTLFSKSAMDFFYSVLKK- 255

  Fly   253 IEFREEHNVV---RKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMSIEKIAAQAFLFYVA 314
              .:::||..   |.|.|:|:::    .:|  .|||:.|.:|:::..|.::..:|.:|:.:|.:.
Zfish   256 --IKDDHNKESEGRVDFLKLMLQ----NQI--PDDQIQDSDTSEQPAKGLTDHEILSQSLVFILG 312

  Fly   315 GSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDICIMETIR 379
            |.|:|:....|.||.|:..|:.|::..||:|     .|.......||:|:..:.:|::.|.|::|
Zfish   313 GYETTSTTLTFLLYNLATNPDCLEKLVEEID-----KNFPLDTPITYDALMRMDYLEMAINESMR 372

  Fly   380 KYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGMQRDPVYFPNPNGYDPHRFD-SNNMNYD 443
            ..|..|.|.|...:...:.|..  |.:||.:.|..:.:..||..:.:|..:.|.||. .|...:.
Zfish   373 LLPTAPRLERSAKKTVVINGLT--IPEGTLVGIPTYVLSHDPDIWESPGEFRPERFSPENKSEFL 435

  Fly   444 QAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSPRKEVEFRFDAAPVLVTKEPLKLRL 508
            |.|::|||.|||:||.:|...:..|:.|.|:|.||.:  ...||.:...:.......|.|:.|:|
Zfish   436 QYAFIPFGLGPRNCIGMRYAVMIMKLFVVKLLQNFSV--ETCKETQIPLEMNVTFQPKVPITLKL 498

  Fly   509 TKR 511
            ..|
Zfish   499 IPR 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 116/453 (26%)
cyp3c4NP_001071016.1 p450 38..485 CDD:278495 120/474 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.