DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and Cyp9c1

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_523850.1 Gene:Cyp9c1 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster

Alignment Length:509 Identity:144/510 (28%)
Similarity:256/510 (50%) Gaps:51/510 (10%)


  Fly     6 LTILIAG---LLYRYVKRHYTHWQRLGV-DEEP----AKIPFGVMDTVMKQERSLGMALADIYAR 62
            |:|.:|.   |||::....:.::.:.|| .|:|    ..||:.|:   |.:|..:..:: |::.|
  Fly     6 LSIFVAFIGLLLYKWSVYTFGYFSKRGVAHEKPIPLLGNIPWSVL---MGKESYIKHSI-DLHLR 66

  Fly    63 -HEGKIVGIYMLNKRSILIRDAQLARQIMTSDFASF--HDRGVYVD-EDKDPLSANLFNLRGASW 123
             .:.|:.|::.|......:.|.:|.||:...:|.:|  |.:|:... .|...:|.:|.:||...|
  Fly    67 LKQHKVYGVFNLRDPLYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRW 131

  Fly   124 RNLRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQ-SDEVEIKDVMTTYAVDIIGSVIFG 187
            :.:|..|||:|:|.||:.||..|.....:.|..::..||. :.|:|:||..|.|..|:|.:..||
  Fly   132 KQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAGTSELELKDFFTRYTNDVIATAAFG 196

  Fly   188 LEIDSFRNPKNEFREISSSTSRDESLL---LKIHNMSMFICPPIAKL-------MNRLGYESRIL 242
            ::::||::|.|||..|....|  |...   ||:  |...:.|.:.|.       ||.:.|..:::
  Fly   197 IQVNSFKDPNNEFFSIGQRIS--EFTFWGGLKV--MLYILMPKLMKALRVPVMDMNNVDYFKKLV 257

  Fly   243 TSLRDMMKRTIEFREEHNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKS-MSIEKIAA 306
            ..       .:::|:|.::||.||:.||:..:...|.    :|....|:|.:|.|: .:.:.:.|
  Fly   258 FG-------AMKYRKEQSIVRPDMIHLLMEAQRQFKA----EQEGSAESAAQQDKAEFNDDDLLA 311

  Fly   307 QAFLFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLD 371
            |..||:.||.|:.|...:||.|||.|.||:.::...|:.||..:...||.|   |:.:..:|:|:
  Fly   312 QCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEKPLD---YDTLMGMKYLN 373

  Fly   372 ICIMETIRKYPGLPFLNRECTEDYPVPGTNHIIA----KGTPILISLFGMQRDPVYFPNPNGYDP 432
            ..:.|::||:|....::|.|..|:.:......:.    :...:.|::..:..||..||.|..:.|
  Fly   374 CVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFRP 438

  Fly   433 HRFDSNNMN-YDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSPR 485
            .|||..:.: ..|..|:|||.|.|.||..|:..:..|..:.:::..:.|..:.|
  Fly   439 ERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKPTDR 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 127/442 (29%)
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 135/479 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50440
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I2561
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.