DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and Cyp3a44

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_796354.1 Gene:Cyp3a44 MGIID:2449818 Length:504 Species:Mus musculus

Alignment Length:524 Identity:145/525 (28%)
Similarity:263/525 (50%) Gaps:52/525 (10%)


  Fly     3 TILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADIYARHEGKI 67
            |::|..:|..|||||..|.:..:::.|: ..|..:||  :.||:.....:.....:.|.:: ||.
Mouse    11 TLVLLAIILVLLYRYGTRTHGLFKKQGI-PGPKPLPF--LGTVLNYYTGIWKFDMECYEKY-GKT 71

  Fly    68 VGIYMLNKRSILIRDAQLARQIMTSDFAS-FHDR-----------GVYVDEDKDPLSANLFNLRG 120
            .|::......::|.|.:..:.::..|..| |.:|           .:.:.:|::           
Mouse    72 WGLFDGQTPLLVITDPETIKNVLVKDCLSVFTNRREFGPVGIMSKAISISKDEE----------- 125

  Fly   121 ASWRNLRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVI 185
              |:..|..|:|:|:||::|.||..|:..||.||::|....::...|.:|||:..|::|:|.|..
Mouse   126 --WKRYRALLSPTFTSGRLKEMFPVIEQYGDILVKYLRQEAEKGMPVAMKDVLGAYSMDVITSTS 188

  Fly   186 FGLEIDSFRNPKNEFREISSSTSRDESLLLKIHNMSMF-ICPPIAKLMNRLGYESRILTSLRDMM 249
            ||:.:||..||::.|.|.:....|.:.....:.::.:| :..|:.:::|...:.:..:...:..:
Mouse   189 FGVNVDSLNNPEDPFVEEAKKFLRVDFFDPLLFSVVLFPLLTPVYEMLNICMFPNDSIEFFKKFV 253

  Fly   250 KRTIEFREEHNVV-RKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMSIEKIAAQAFLFYV 313
            .|..|.|.:.|.. |.|.|||::...|..|   |.|          ..|:.|..:|..|:.:|..
Mouse   254 DRMQESRLDSNQKHRVDFLQLMMNSHNNSK---DKD----------SHKAFSNMEITVQSIIFIS 305

  Fly   314 AGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDICIMETI 378
            ||.|:|::..:||||.|:.:|::.|:.|.|:|..|..     |...|.:.|.::::||:.:.||:
Mouse   306 AGYETTSSTLSFTLYCLATHPDIQKKLQAEIDKALPN-----KATPTCDTVMEMEYLDMVLNETL 365

  Fly   379 RKYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGMQRDPVYFPNPNGYDPHRFDSNNM-NY 442
            |.||.:..|.|.|.:|..:.|.  .|.||:.::|..:.:..||.::|:|..:.|.||...|. :.
Mouse   366 RLYPIVTRLERVCKKDVELNGV--YIPKGSMVMIPSYALHHDPQHWPDPEEFQPERFSKENKGSI 428

  Fly   443 DQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSPRKEVEFRFDAAPVLVTKEPLKLR 507
            |...|:|||.|||:||.:|...:|.|:||.|:|.||........::..:.....:|..::|:.|:
Mouse   429 DPYVYLPFGIGPRNCIGMRFALMNMKLAVTKVLQNFSFQPCQETQIPLKLSRQGILQPEKPIVLK 493

  Fly   508 LTKR 511
            :..|
Mouse   494 VVPR 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 127/456 (28%)
Cyp3a44NP_796354.1 p450 39..494 CDD:278495 134/491 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.