DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and cyp-13A5

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_496112.1 Gene:cyp-13A5 WormBaseID:WBGene00011672 Length:520 Species:Caenorhabditis elegans

Alignment Length:539 Identity:136/540 (25%)
Similarity:261/540 (48%) Gaps:57/540 (11%)


  Fly     6 LTILIAGLLYRYVKRHY----THWQRLGVDEEPAKIP-FGVMDTVMKQERSLGMALADIYARHEG 65
            |:|||||..:..:..:|    :.|.|.|| :.|...| |||:......|.. |:.....:.:..|
 Worm     3 LSILIAGASFIGLLTYYIWIWSFWIRKGV-KGPRGFPFFGVIHEFQDYENP-GLLKLGEWTKEYG 65

  Fly    66 KIVGIYMLNKRSILIRDAQLARQIMTSDFASFHDR---GVYVDEDKDPLSANLFNLRGASWRNLR 127
            .|.||....::::::.:.:...::....|.:|:.|   .:..|.:|:. .|:|.:.:|..|:.||
 Worm    66 PIYGITEGVEKTLIVSNPEFVHEVFVKQFDNFYGRKTNPIQGDPNKNK-RAHLVSAQGHRWKRLR 129

  Fly   128 QKLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVIFG-LEID 191
            ...:|:||:..::.:..|:::...:|::||:.|..:...|::.|....:.:||||.:..| .|..
 Worm   130 TLSSPTFSNKNLRKIMSTVEETVVELMRHLDDASAKGKAVDLLDYYQEFTLDIIGRIAMGQTESL 194

  Fly   192 SFRNP-----KNEFREISSSTSRDESLLLKIHNMSMFICPPIAKLMNR---LGYES-----RILT 243
            .||||     |..|::     .|....|:.    .:|   |||..|.|   :.:.|     .|::
 Worm   195 MFRNPMLPKVKGIFKD-----GRKLPFLVS----GIF---PIAGTMFREFFMRFPSIQPAFDIMS 247

  Fly   244 SLRDMMKRTIEFRE-------EHNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQL-KSMS 300
            ::...:.:.:|.|.       |.:...:|.:.|.:..|......|::..:...:|...:: |.::
 Worm   248 TVEKALNKRLEQRAADEKAGIEPSGEPQDFIDLFLDARANVDFFEEESALGFAKTEIAKVDKQLT 312

  Fly   301 IEKIAAQAFLFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQ 365
            .::|..|.|:|.:||.::||.:.:::.|.|:.:||:.|:.|||||...      |....|::.:.
 Worm   313 FDEIIGQLFVFLLAGYDTTALSLSYSSYLLARHPEIQKKLQEEVDREC------PNPEVTFDQIS 371

  Fly   366 DLKFLDICIMETIRKYPGLPFL-NRECTEDYPVPGTNHIIAKGTPILISLFGMQRDP-VYFPNPN 428
            .||:::..:.|.:|.||....: ||:|.::..|.|..  |.|||.:.:..:.:..|| |:..:.|
 Worm   372 KLKYMECVVKEALRMYPLASIVHNRKCMKETNVLGVQ--IEKGTNVQVDTWTLHYDPKVWGEDAN 434

  Fly   429 GYDPHRFDS-NNMNYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSPRKEVEFRF 492
            .:.|.|::| :.:.|.:..|:|||.|||.||.:|:..:..|:.:..||..:....|.:.|:..:.
 Worm   435 EFRPERWESGDELFYAKGGYLPFGMGPRICIGMRLAMMEKKMLLTHILKKYTFETSTQTEIPLKL 499

  Fly   493 DAAPVLVTKEPLKLRLTKR 511
            ..:.....:. :.|:||.|
 Worm   500 VGSATTAPRS-VMLKLTPR 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 114/469 (24%)
cyp-13A5NP_496112.1 p450 33..514 CDD:278495 122/504 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I2561
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97993
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.716 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.