DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d2 and Cyp3a62

Sequence 1:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001019403.1 Gene:Cyp3a62 RGDID:1595919 Length:497 Species:Rattus norvegicus

Alignment Length:542 Identity:147/543 (27%)
Similarity:265/543 (49%) Gaps:89/543 (16%)


  Fly     2 WTILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADIYA----- 61
            |.:|.|||:  |||.|....:.::::||: ..|..:||            :|..||..:.     
  Rat    12 WMLLATILV--LLYLYGTSTHGNFKKLGI-SGPKPLPF------------VGNILAYRHGFWEFD 61

  Fly    62 RH----EGKIVGIYMLNKRSILIRDAQLARQIMTSD-FASFHDR-----------GVYVDEDKDP 110
            ||    .|.|.|.|...:..:.|.|..:.:.::..: :::|.:|           .:.:.||:: 
  Rat    62 RHCHKKYGDIWGFYEGRQPILAITDPDIIKTVLVKECYSTFTNRRSFGPAGILKKAITLSEDEE- 125

  Fly   111 LSANLFNLRGASWRNLRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTT 175
                        |:.||..|:|:|:|||:|.||..|:...|.||::::...::.:.:.:||:...
  Rat   126 ------------WKRLRTLLSPTFTSGKLKEMFPIINQYADLLVKNVKHEAEKGNPITMKDIFGA 178

  Fly   176 YAVDIIGSVIFGLEIDSFRNPKNEF-REISSSTSRDESLLLKIH-----NMSMFICP---PIAKL 231
            |::|:|....||:.:||..||:|.| :::..        |||.:     .:|:.:.|   |:.:.
  Rat   179 YSMDVITGTSFGVNVDSLNNPQNPFVQKVKK--------LLKFNFLDPFFLSVILFPFLTPVFEA 235

  Fly   232 MNRLGYESRILTSLRDMMKRTIEFREEHNV-VRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQ 295
            .:...:...::...|..::|..|.|.:..| .|.|.|||:|..:::|          |.|:.|  
  Rat   236 FDITVFPKDVMKFFRTSVERMKENRMQEKVKQRLDFLQLMINSQSSG----------DKESHQ-- 288

  Fly   296 LKSMSIEKIAAQAFLFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFT 360
              .::..:|.||:..|..||.|:|::|.:|.||.|:.:|:|.|:.|:|:||.|..     |...|
  Rat   289 --GLTDVEIVAQSIFFIFAGYETTSSALSFALYLLATHPDLQKKLQDEIDAALPN-----KAPVT 346

  Fly   361 YEAVQDLKFLDICIMETIRKYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGMQRDPVYFP 425
            |:.:.::::||:.:.||:|.:|....|.|.|.:|..:.|.  .|.|||.:::..|.:.:||..:|
  Rat   347 YDVLVEMEYLDMVLNETLRLFPVGGRLERVCKKDVEINGV--FIPKGTVVMVPTFALHKDPKCWP 409

  Fly   426 NPNGYDPHRFDSNNM-NYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSPRKEVE 489
            .|..:.|.||...|. :.:...|:|||.|||:||.:|...:|.|:|:.::|.||........::.
  Rat   410 EPEEFCPERFRKKNQDSINPYIYLPFGNGPRNCIGMRFALMNMKIALVRVLQNFSFGLCKETQIP 474

  Fly   490 FRFDAAPVLVTKEPLKLRLTKR 511
            .:.........::|:.||...|
  Rat   475 LKLRKKGFFQPEKPIILRAVSR 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 125/464 (27%)
Cyp3a62NP_001019403.1 p450 39..491 CDD:278495 133/506 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.