DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and PPIG

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_004783.2 Gene:PPIG / 9360 HGNCID:14650 Length:754 Species:Homo sapiens


Alignment Length:176 Identity:96/176 - (54%)
Similarity:116/176 - (65%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GPKVTE-KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG--------YKGSKFH 79
            |.||.. :.||||.|..:||||:...||....|||.|||:.|....:|.|        ||...||
Human     2 GIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFH 66

  Fly    80 RIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQT 144
            |::||||:|||||::|:|.||.||||..||||:|.:||.....|||||.||||||||||||||.|
Human    67 RVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPT 131

  Fly   145 SWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            ..|||.|||||:::||..|||:|||..|||..:|..:|.|.:.|.|
Human   132 PHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 91/165 (55%)
PPIGNP_004783.2 cyclophilin 8..175 CDD:469651 91/166 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..754
PTZ00121 <392..752 CDD:173412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.