DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and SQN

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_565381.1 Gene:SQN / 816074 AraportID:AT2G15790 Length:361 Species:Arabidopsis thaliana


Alignment Length:170 Identity:96/170 - (56%)
Similarity:120/170 - (70%) Gaps:8/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG--------YKGSKFHRIIKDFM 86
            |.|.||:||||..|||.|.|:...||||.|||:.|....:|.|        |||::|||:||.||
plant     5 KCFMDISIGGELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNRFHRVIKGFM 69

  Fly    87 IQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRH 151
            |||||.:..|||||.||||.:|:||||:|||...|.|||||:|.:||||||||||.:||.|||:|
plant    70 IQGGDISANDGTGGESIYGLKFDDENFELKHERKGMLSMANSGPNTNGSQFFITTTRTSHLDGKH 134

  Fly   152 VVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLP 191
            ||||::..||.|||.||:.:.:.:..|.:||||.:.|.:|
plant   135 VVFGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGEIP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 94/165 (57%)
SQNNP_565381.1 cyclophilin_ABH_like 4..171 CDD:238907 94/165 (57%)
TPR 213..>332 CDD:440225
TPR repeat 263..293 CDD:276809
TPR repeat 298..326 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.