DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and RANBP2

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_005264059.1 Gene:RANBP2 / 5903 HGNCID:9848 Length:3258 Species:Homo sapiens


Alignment Length:139 Identity:80/139 - (57%)
Similarity:101/139 - (72%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKG 95
            ||||:...|||.|||.:.||...||:|.|||:.|....:|.|:|.|.|||:|.||:.||||.||.
Human  3100 VFFDVCADGEPLGRITMELFSNIVPRTAENFRALCTGEKGFGFKNSIFHRVIPDFVCQGGDITKH 3164

  Fly    96 DGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSG 160
            |||||:||||::||||||.:||.|.|.|||||.|::||.|||.||.|:...||.:|||||.:..|
Human  3165 DGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQNTNNSQFVITLKKAEHLDFKHVVFGFVKDG 3229

  Fly   161 MNVVRQIEN 169
            |:.|::||:
Human  3230 MDTVKKIES 3238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 80/139 (58%)
RANBP2XP_005264059.1 LapB <33..222 CDD:442196
TPR repeat 59..89 CDD:276809
TPR repeat 94..123 CDD:276809
RanBD1_RanBP2-like 1186..1302 CDD:270203
zf-RanBP 1351..1381 CDD:395516
RanBP2-type Zn finger 1355..1375 CDD:275375
zf-RanBP 1415..1443 CDD:395516
RanBP2-type Zn finger 1419..1438 CDD:275375
zf-RanBP 1479..1508 CDD:395516
RanBP2-type Zn finger 1483..1502 CDD:275375
zf-RanBP 1543..1572 CDD:395516
RanBP2-type Zn finger 1547..1566 CDD:275375
zf-RanBP 1606..1635 CDD:395516
RanBP2-type Zn finger 1610..1629 CDD:275375
zf-RanBP 1665..1694 CDD:395516
RanBP2-type Zn finger 1669..1688 CDD:275375
zf-RanBP 1724..1753 CDD:395516
RanBP2-type Zn finger 1728..1747 CDD:275375
zf-RanBP 1781..1809 CDD:395516
RanBP2-type Zn finger 1785..1804 CDD:275375
RanBD2_RanBP2-like 2027..2143 CDD:269998
RanBD3_RanBP2-like 2324..2440 CDD:270204
IR1-M 2657..2719 CDD:463488
IR1-M 2735..2791 CDD:463488
RanBD4_RanBP2-like 2959..3075 CDD:269999
cyclophilin_ABH_like 3098..3256 CDD:238907 80/139 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.