DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and PPID

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_005029.1 Gene:PPID / 5481 HGNCID:9257 Length:370 Species:Homo sapiens


Alignment Length:169 Identity:95/169 - (56%)
Similarity:114/169 - (67%) Gaps:9/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG--------YKGSKFHRIIKDFM 86
            :||||:.||||..|||.:.||...||||.|||:.|....:|.|        :||..||||||.||
Human    17 RVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFHRIIKKFM 81

  Fly    87 IQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRH 151
            ||||||:..:||||.|||||:||||||..||...|.|||||||::||||||||||..|..|||:|
Human    82 IQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTPHLDGKH 146

  Fly   152 VVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            ||||:::.|:.|.|.:||..... ::|.|..|||..|.|
Human   147 VVFGQVIKGIGVARILENVEVKG-EKPAKLCVIAECGEL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 93/165 (56%)
PPIDNP_005029.1 cyclophilin_ABH_like 16..182 CDD:238907 93/165 (56%)
Chaperone activity. /evidence=ECO:0000250 185..215 95/169 (56%)
TPR 213..>367 CDD:440225
Interaction with HSP90AB1. /evidence=ECO:0000250 214..370
TPR repeat 224..267 CDD:276809
TPR repeat 272..302 CDD:276809
TPR repeat 307..333 CDD:276809
TPR repeat 341..364 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.