| Sequence 1: | NP_611695.1 | Gene: | CG2852 / 37591 | FlyBaseID: | FBgn0034753 | Length: | 205 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001001234.1 | Gene: | ppig / 407915 | XenbaseID: | XB-GENE-5805534 | Length: | 736 | Species: | Xenopus tropicalis |
| Alignment Length: | 42 | Identity: | 13/42 - (30%) |
|---|---|---|---|
| Similarity: | 23/42 - (54%) | Gaps: | 7/42 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 200 VVFCIAAVVGSLTAHSIFQAPLIIAMEI-SKSERRGHISMMQ 240 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2852 | NP_611695.1 | cyclophilin | 30..188 | CDD:469651 | |
| ppig | NP_001001234.1 | cyclophilin_ABH_like | 9..175 | CDD:238907 | 13/42 (31%) |
| PTZ00121 | <282..717 | CDD:173412 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||