DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and PPIL2

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_011528343.1 Gene:PPIL2 / 23759 HGNCID:9261 Length:616 Species:Homo sapiens


Alignment Length:145 Identity:65/145 - (44%)
Similarity:94/145 - (64%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGER 107
            |.:.:.|.....|||.|||..|..|   ..|.|:.|||.|::|:|||||.| |.||||.|.:|:.
Human   289 GDLNLELHCDLTPKTCENFIRLCKK---HYYDGTIFHRSIRNFVIQGGDPT-GTGTGGESYWGKP 349

  Fly   108 FEDENFK--LKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENS 170
            |:|| |:  |.|.|.|.|||||:|.::|.||||||.:..::||.:|.:||:::.|.:|:..:||.
Human   350 FKDE-FRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENV 413

  Fly   171 ATDAR-DRPVKDVVI 184
            .:|.: |||.:::.|
Human   414 ESDPKTDRPKEEIRI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 65/145 (45%)
PPIL2XP_011528343.1 RING-Ubox_PPIL2 38..110 CDD:438325
RING_Ubox 100..159 CDD:473075
cyclophilin_RING 281..440 CDD:238904 65/145 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.