DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and cyn-15

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_493378.1 Gene:cyn-15 / 173225 WormBaseID:WBGene00000891 Length:629 Species:Caenorhabditis elegans


Alignment Length:193 Identity:83/193 - (43%)
Similarity:106/193 - (54%) Gaps:30/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VADDSKGPKVTEKVFF-------DI-----TIGGEPA-----------GRIEIGLFGKTVPKTVE 59
            |.||...|.|:.:..|       |:     |.|||..           |.|.|.|||...|||||
 Worm   435 VEDDEGNPSVSGRDVFNERPKKEDLLTALDTEGGEKVLNKEAIIHTSFGDITIRLFGDECPKTVE 499

  Fly    60 NFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDE-NFKLKHYGAGWL 123
            ||   ....:...|.|..|||:||.||||.|| ..|.||||.||:||.|||| :.:|:|.....:
 Worm   500 NF---CTHSRRGYYNGLTFHRVIKSFMIQTGD-PSGKGTGGESIWGEDFEDEFHPRLRHDKPFKV 560

  Fly   124 SMANA-GKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARD-RPVKDVVI 184
            ||||| |.:|||||||||.....||||::.:||::.:||:||::|...:|..|. ||.:.:.|
 Worm   561 SMANAGGGNTNGSQFFITVCPADWLDGKNTLFGEVTAGMSVVQRINQVSTFERSGRPRESIQI 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 78/181 (43%)
cyn-15NP_493378.1 WD40 53..>285 CDD:475233
WD40 repeat 101..142 CDD:293791
WD40 repeat 150..185 CDD:293791
WD40 repeat 192..237 CDD:293791
cyclophilin 477..626 CDD:469651 72/151 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.