DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and AT1G74330

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_177573.2 Gene:AT1G74330 / 843774 AraportID:AT1G74330 Length:699 Species:Arabidopsis thaliana

Alignment Length:382 Identity:149/383 (39%)
Similarity:207/383 (54%) Gaps:55/383 (14%)


  Fly    10 QPSGSTPSNVGSSSSR-----TMSLMEKQKYIEDYD--------------------FPYCDESNK 49
            |.||   |.:||.|.|     :..|....:|:|...                    .|.  .|:.
plant    61 QKSG---SELGSESGRASDSLSFRLGNVSRYLEAEQVAAGWPAWLSNVAGEAIHGWVPL--RSDA 120

  Fly    50 YEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDN-EKEGFPITALREIRILQLLKHENVVNL 113
            :||:.||||||:..||:|.|.: ..:.||:|||..|| |.|.....| |||.||:.|.|.|::.|
plant   121 FEKLEKIGQGTYSNVFRAVETE-TGRIVALKKVRFDNFEPESVKFMA-REILILRRLNHPNIIKL 183

  Fly   114 IEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKIL 178
            ..:..:|.:.      ...|||::.||||.||||:.::||:..:||..|:|||:||.:.||..::
plant   184 EGLITSKLSC------NIQLVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVM 242

  Fly   179 HRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVD 243
            |||:|.:|:|::..||||:||||||. ||......|...|:|||||||||||||||..:||..||
plant   243 HRDIKGSNLLLSNEGILKVADFGLAN-FSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVD 306

  Fly   244 MWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPK----NQK 304
            :|..||:.||:....||::|.||.:||..|.:||||...|.|         |..:||.    ..:
plant   307 LWSVGCVFAELLLGKPILRGRTEVEQLHKIFKLCGSPPEDYW---------KKSKLPHAMLFKPQ 362

  Fly   305 RRVKERLRPYVKD--QTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKM 359
            :.....||..:||  :|..:|::.||::||.||..|.:||...:|.|.|...|.|.:
plant   363 QTYDSCLRETLKDLSETEINLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSL 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 134/337 (40%)
S_TKc 50..347 CDD:214567 131/304 (43%)
AT1G74330NP_177573.2 STKc_CDK9_like 121..407 CDD:270832 131/304 (43%)
PTZ00024 127..420 CDD:240233 133/312 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D925637at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24056
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.