DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cdk9 and IBS1

Sequence 1:NP_477226.2 Gene:Cdk9 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001321211.1 Gene:IBS1 AraportID:AT1G18670 Length:720 Species:Arabidopsis thaliana

Alignment Length:377 Identity:145/378 (38%)
Similarity:203/378 (54%) Gaps:51/378 (13%)


  Fly    12 SGSTPSNVGSSSSRTMSLMEKQKYIEDYD--------------------FPYCDESNKYEKVAKI 56
            ||...||. .|.|.:..|....||:|...                    .|:  .|:.:||:.||
plant    76 SGRASSNC-RSESVSFRLGNLSKYLEAEQVAAGWPAWLSNVAGEAIHGWVPF--RSDAFEKLEKI 137

  Fly    57 GQGTFGEVFKAREKKGNKKFVAMKKVLMDN-EKEGFPITALREIRILQLLKHENVVNLIEICRTK 120
            ||||:..||:|||.: ..:.||:|||..|| |.|.....| |||.||:.|.|.|::.|..|..:|
plant   138 GQGTYSSVFRARETE-TGRIVALKKVRFDNFEPESVRFMA-REILILRKLNHPNIIKLEGIVTSK 200

  Fly   121 ATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAA 185
            .:.      :.:|||::.||||.||||:.::.|:..:||..|:|||:||.:.|:..::|||:|.:
plant   201 LSC------SIHLVFEYMEHDLTGLLSSPDIDFTTPQIKCYMKQLLSGLDHCHARGVMHRDIKGS 259

  Fly   186 NVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCI 250
            |:|:...||||:||||||...:...|  |...|:|||||||||||||||...||..||:|..||:
plant   260 NLLVNNEGILKVADFGLANFCNASGN--KQPLTSRVVTLWYRPPELLLGATEYGASVDLWSVGCV 322

  Fly   251 MAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELP-----KNQKRR---V 307
            .||:....|::||.||.:||..|.:||||...|.|         |..:||     |.|:..   :
plant   323 FAELLIGKPVLQGRTEVEQLHKIFKLCGSPPEDYW---------KKSKLPHAMLFKPQQHYDGCL 378

  Fly   308 KERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKM 359
            :|.|:.........:|::.||::.|.||..|.|||...:|.:.|...|.|.:
plant   379 RETLKLKGLSDADINLIETLLSIQPHKRGTASTALVSQYFTSKPFACDPSSL 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 132/339 (39%)
S_TKc 50..347 CDD:214567 129/306 (42%)
IBS1NP_001321211.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D925637at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24056
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.