DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and AT5G50860

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_199899.1 Gene:AT5G50860 / 835158 AraportID:AT5G50860 Length:580 Species:Arabidopsis thaliana

Alignment Length:360 Identity:153/361 (42%)
Similarity:204/361 (57%) Gaps:41/361 (11%)


  Fly    18 NVGSSSSRTMSLMEKQKYIEDYDFPYCDESNK---------YEKVAKIGQGTFGEVFKAREKKGN 73
            :.|||....|||...:.: ..:....|.:|.|         |||:.||||||:..|:||::....
plant    74 SAGSSRRPGMSLRTPEGW-PPWLIAACGDSIKDLTPRRATTYEKLEKIGQGTYSNVYKAKDLLSG 137

  Fly    74 KKFVAMKKVLMDN-EKEGFPITALREIRILQLLKHENVVNLIEICRTKATATNGYRSTFYLVFDF 137
             |.||:|||..|| |.|.....| |||.:|:.|.|.||:.|      :...|:....:.||||::
plant   138 -KIVALKKVRFDNLEAESVKFMA-REILVLRRLNHPNVIKL------QGLVTSRVSCSLYLVFEY 194

  Fly   138 CEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGL 202
            .||||:||.:...:||.|.::|..|:|||:||.:.||..:||||:|.:|:||...||||:|||||
plant   195 MEHDLSGLAATQGLKFDLPQVKCFMKQLLSGLEHCHSRGVLHRDIKGSNLLIDNDGILKIADFGL 259

  Fly   203 ARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQ 267
            | .|..||  .|...|:|||||||||||||||..:||..||:|.|||||||:....|:|.|.||.
plant   260 A-TFYDPK--QKQTMTSRVVTLWYRPPELLLGATSYGTGVDLWSAGCIMAELLAGKPVMPGRTEV 321

  Fly   268 QQLTFISQLCGSFTPDVWPGVEELELYKSIELP-----KNQ---KRRVKERLRPYVKDQTGCDLL 324
            :||..|.:||||.:...|         |...||     |.|   ||.|.|....:.  .:...|:
plant   322 EQLHKIFKLCGSPSDSYW---------KKYRLPNATLFKPQHPYKRCVAEAFNGFT--PSSVHLV 375

  Fly   325 DKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKM 359
            :.|||:||..|..:.:|||.:||.|:|:|.|.|.:
plant   376 ETLLTIDPADRGTSTSALNSEFFTTEPLPCDPSSL 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 141/328 (43%)
S_TKc 50..347 CDD:214567 138/306 (45%)
AT5G50860NP_199899.1 STKc_CDK9_like 114..398 CDD:270832 138/306 (45%)
S_TKc 114..398 CDD:214567 138/306 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D925637at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.