DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and CDKC;1

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_196589.1 Gene:CDKC;1 / 830891 AraportID:AT5G10270 Length:505 Species:Arabidopsis thaliana

Alignment Length:341 Identity:157/342 (46%)
Similarity:225/342 (66%) Gaps:16/342 (5%)


  Fly    50 YEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLI 114
            :||:.:||:||:|:|:.|:|.| ..:.||:||:.||||:|||||||:|||:||:.|.||||:.|.
plant    26 FEKLEQIGEGTYGQVYMAKEIK-TGEIVALKKIRMDNEREGFPITAIREIKILKKLHHENVIQLK 89

  Fly   115 EICRTKA--------TATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYY 171
            ||..:..        ...|.|:...|:||::.:|||.||.....::|::.:||..|:|||.||:|
plant    90 EIVTSPGRDRDDQGKPDNNKYKGGIYMVFEYMDHDLTGLADRPGLRFTVPQIKCYMKQLLTGLHY 154

  Fly   172 IHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDR 236
            .|.|::||||:|.:|:||...|.||||||||||::|   ::.....||||:||||||||||||..
plant   155 CHVNQVLHRDIKGSNLLIDNEGNLKLADFGLARSYS---HDHTGNLTNRVITLWYRPPELLLGAT 216

  Fly   237 NYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPK 301
            .|||.:|||..|||.||:....||:.|..||:||..|.:||||....:||||.::..:.:.:..:
plant   217 KYGPAIDMWSVGCIFAELLHAKPILPGKNEQEQLNKIFELCGSPDEKLWPGVSKMPWFNNFKPAR 281

  Fly   302 NQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKMLSQHLQS 366
            ..||||:|..|.:  |:...:||:|:|.|||.:||.|..||:.::|||||:|.| .|.|..: :|
plant   282 PLKRRVREFFRHF--DRHALELLEKMLVLDPAQRISAKDALDAEYFWTDPLPCD-PKSLPTY-ES 342

  Fly   367 MFEYLAQPRRSNQMRN 382
            ..|:..:.:|..|.:|
plant   343 SHEFQTKKKRQQQRQN 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 143/305 (47%)
S_TKc 50..347 CDD:214567 143/305 (47%)
CDKC;1NP_196589.1 STKc_CDK9_like 26..325 CDD:270832 143/305 (47%)
PTZ00024 32..338 CDD:240233 150/313 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 305 1.000 Inparanoid score I739
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D925637at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24056
Phylome 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.