DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cdk9 and AT4G10010

Sequence 1:NP_477226.2 Gene:Cdk9 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001328367.1 Gene:AT4G10010 AraportID:AT4G10010 Length:649 Species:Arabidopsis thaliana

Alignment Length:319 Identity:135/320 (42%)
Similarity:187/320 (58%) Gaps:25/320 (8%)


  Fly    47 SNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVL---MDNEKEGFPITALREIRILQLLKHE 108
            :..:||:.||||||:..|::||:.: ..|.||||||.   ||.|...|   ..|||.||:.|.|.
plant   153 AESFEKLDKIGQGTYSSVYRARDLE-TGKMVAMKKVRFVNMDPESVRF---MAREINILRKLDHP 213

  Fly   109 NVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIH 173
            ||:.|      :...|:....:.||||::.||||:||.....|||:..:||..|:|||:||.:.|
plant   214 NVMKL------ECLVTSKLSGSLYLVFEYMEHDLSGLALRPGVKFTESQIKCYMKQLLSGLEHCH 272

  Fly   174 SNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNY 238
            |..|||||:|..|:|:...|:||:.|||||   :|...|.....|:||||||||.||||||...|
plant   273 SRGILHRDIKGPNLLVNNDGVLKIGDFGLA---NIYHPEQDQPLTSRVVTLWYRAPELLLGATEY 334

  Fly   239 GPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQ 303
            ||.:|:|..|||:.|::...|||.|.||.:|:..|.:.|||.:.|.|... :|.|..|.:..:..
plant   335 GPGIDLWSVGCILTELFLGKPIMPGRTEVEQMHKIFKFCGSPSDDYWQKT-KLPLATSFKPQQPY 398

  Fly   304 KRRVKE---RLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKM 359
            ||.:.|   .|.|     :...|:||||:|:|.||..|.:.|:..||..:|:|.::|.:
plant   399 KRVLLETFKNLPP-----SALALVDKLLSLEPAKRGTASSTLSSKFFTMEPLPCNVSSL 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 131/306 (43%)
S_TKc 50..347 CDD:214567 131/303 (43%)
AT4G10010NP_001328367.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D925637at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24056
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.