| Sequence 1: | NP_477226.2 | Gene: | Cdk9 / 37586 | FlyBaseID: | FBgn0019949 | Length: | 404 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001325617.1 | Gene: | AT3G01085 / 821283 | AraportID: | AT3G01085 | Length: | 631 | Species: | Arabidopsis thaliana |
| Alignment Length: | 358 | Identity: | 139/358 - (38%) |
|---|---|---|---|
| Similarity: | 207/358 - (57%) | Gaps: | 40/358 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 50 YEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDN-EKEGFPITALREIRILQLLKHENVVNL 113
Fly 114 IEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKIL 178
Fly 179 HRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVD 243
Fly 244 MWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIEL--PKNQ-KR 305
Fly 306 RVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPM---PSDLSKMLSQHLQSM 367
Fly 368 FEYLAQPRRSNQMRNYHQQLTTMNQ---KPQDN 397 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cdk9 | NP_477226.2 | STKc_CDK9 | 37..347 | CDD:270848 | 126/300 (42%) |
| AT3G01085 | NP_001325617.1 | None | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D925637at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24056 |
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 4.020 | |||||