DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and AT3G01085

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001325617.1 Gene:AT3G01085 / 821283 AraportID:AT3G01085 Length:631 Species:Arabidopsis thaliana

Alignment Length:358 Identity:139/359 (39%)
Similarity:207/359 (58%) Gaps:40/359 (11%)


  Fly    50 YEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDN-EKEGFPITALREIRILQLLKHENVVNL 113
            :||..||||||:..||:|.| ....:.:|:||:.:.| |.|.....| |||.||:.|.|.|::.|
plant   115 FEKREKIGQGTYSNVFRACE-VSTGRVMALKKIRIQNFETENIRFIA-REIMILRRLDHPNIMKL 177

  Fly   114 IEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKIL 178
            ..|..::.:      ::.|.|||:.||||.||.|:.::||:..:||..|:|||.|:.:.|...|:
plant   178 EGIIASRNS------NSMYFVFDYMEHDLEGLCSSPDIKFTEAQIKCYMKQLLWGVEHCHLRGIM 236

  Fly   179 HRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVD 243
            |||:||||:|:...|:|||||||||...: |:|  ||:.|:||||||||.||||:|..:|...||
plant   237 HRDIKAANILVNNKGVLKLADFGLANIVT-PRN--KNQLTSRVVTLWYRAPELLMGSTSYSVSVD 298

  Fly   244 MWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIEL--PKNQ-KR 305
            :|..||:.||:.|..|:::|.||.:||..|.:|.||...:.|   |:.:|:...::  |::| :.
plant   299 LWSVGCVFAEILTGRPLLKGRTEIEQLHKIYKLSGSPDEEFW---EKNKLHPQTKMFRPQHQYEG 360

  Fly   306 RVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPM---PSDLSKMLSQHLQSM 367
            .::||...:.|  |..:||:.||::||:||..|.:||..::|.|.|.   ||.|.|         
plant   361 CLRERFDEFPK--TAINLLENLLSIDPEKRGTASSALMSEYFNTQPYACDPSTLPK--------- 414

  Fly   368 FEYLAQPRRSNQMRNYHQQLTTMNQ---KPQDN 397
                 .|........|.::|....:   |.:||
plant   415 -----YPPNKEMDAKYREELQRRRRVSIKKRDN 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 126/301 (42%)
S_TKc 50..347 CDD:214567 126/301 (42%)
AT3G01085NP_001325617.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D925637at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24056
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.