DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Cdk12

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001103096.1 Gene:Cdk12 / 69131 MGIID:1098802 Length:1484 Species:Mus musculus


Alignment Length:334 Identity:153/334 - (45%)
Similarity:213/334 - (63%) Gaps:15/334 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVN 112
            :|::.:..||:||:|:|:||:: |...:.||:|||.:|||||||||||:|||:||:.|.|::|||
Mouse   721 DKFDIIGIIGEGTYGQVYKAKD-KDTGELVALKKVRLDNEKEGFPITAIREIKILRQLVHQSVVN 784

  Fly   113 LIEICRTKATATN--GYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSN 175
            :.||...|..|.:  ..:..|||||::.:|||.|||.:..|.||...||..|:||:.||.|.|..
Mouse   785 MKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLDYCHKK 849

  Fly   176 KILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGP 240
            ..||||:|.:|:|:...|.:|||||||||.::   :|....|||:|:||||||||||||:..|.|
Mouse   850 NFLHRDIKCSNILLNNSGQIKLADFGLARLYN---SEESRPYTNKVITLWYRPPELLLGEERYTP 911

  Fly   241 PVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKR 305
            .:|:|..|||:.|::|:.||.|.|.|..||..||:||||..|.|||.|.:|..:.:::..|..:|
Mouse   912 AIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRR 976

  Fly   306 RVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKMLS---QHLQSM 367
            |::|.. .:: .....||||.:|||||.||..|:..|..||.    ...:||||..   .|.|..
Mouse   977 RLREEF-SFI-PSAALDLLDHMLTLDPSKRCTAEQTLQSDFL----KDVELSKMAPPDLPHWQDC 1035

  Fly   368 FEYLAQPRR 376
            .|..::.||
Mouse  1036 HELWSKKRR 1044

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 143/300 (48%)
Cdk12NP_001103096.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..465
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 483..699
STKc_CDK12 715..1016 CDD:270847 143/300 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1044..1101 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1156..1199
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1219..1363
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1437..1484
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R186
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.