DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and cdk11b

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_009302607.1 Gene:cdk11b / 494103 ZFINID:ZDB-GENE-041212-74 Length:807 Species:Danio rerio

Alignment Length:374 Identity:144/375 (38%)
Similarity:208/375 (55%) Gaps:28/375 (7%)


  Fly    11 PSGSTPSNVGSSSSRTMSLMEKQKYIEDYDFPY---CDESNKYEKVAKIGQGTFGEVFKAREKKG 72
            || :||.......|..:|.:|.:|.:..| .|.   |....:::.:.:|.:||:|.|::|::|| 
Zfish   410 PS-ATPEERYIPESPPVSPVELKKELPKY-LPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKK- 471

  Fly    73 NKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLIEICRTKATATNGYRSTFYLVFDF 137
            ..:.||:|::.|:.||||||||:||||..:...:|.|:|.:.||      .........|:|.::
Zfish   472 TDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREI------VVGSNMDKIYIVMNY 530

  Fly   138 CEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGL 202
            .||||..|:..|...|..||:|.:|.|||.|:.::|.|.|||||:|.:|:|::..||||:.||||
Zfish   531 VEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVRHLHDNWILHRDLKTSNLLLSHKGILKIGDFGL 595

  Fly   203 ARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQ 267
            ||.:..|...    ||..|||||||.|:||||.:.|...||||..|||..|:.|:.|:..|.:|.
Zfish   596 AREYGSPLKP----YTPVVVTLWYRSPDLLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEI 656

  Fly   268 QQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKRRVKERLRPYVKDQTGCDLLDKLLTLDP 332
            .|:..|.:..||.:..:|||..||...|.:...:.....:::|....:.|| |.||::|.||..|
Zfish   657 DQINKIFKDLGSPSEKIWPGYSELPAVKKMTFTEYPYNNLRKRFGALLSDQ-GFDLMNKFLTYCP 720

  Fly   333 KKRIDADTALNHDFFWTDPMPSDLSKMLSQHLQSMFEYLAQPRRSNQMR 381
            .|||.||.||.|::|...|:|.|         .|||.  ..|.:|.|.|
Zfish   721 AKRISADEALKHEYFRESPLPID---------PSMFP--TWPAKSEQQR 758

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 125/313 (40%)
S_TKc 50..347 CDD:214567 122/297 (41%)
cdk11bXP_009302607.1 STKc_CDC2L1 444..735 CDD:173741 123/303 (41%)
PLN00009 447..737 CDD:177649 123/302 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.