DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Cdk2

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster


Alignment Length:302 Identity:116/302 - (38%)
Similarity:176/302 - (58%) Gaps:22/302 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVN 112
            :.:::..|||:||:|.|:|||.....:. ||:||:.::.|.||.|.||:|||.:|:.|||.|||.
  Fly     6 DNFQRAEKIGEGTYGIVYKARSNSTGQD-VALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69

  Fly   113 LIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKI 177
            |.::      ..:|  :..|::|::...||..|:......|:...||..|.|:|:.:.:.|:|:|
  Fly    70 LFDV------VISG--NNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRI 126

  Fly   178 LHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPV 242
            ||||:|..|:|:...|.:|||||||||||::|    ...||:.|||||||.||:|||.:.|...|
  Fly   127 LHRDLKPQNLLVDTAGKIKLADFGLARAFNVP----MRAYTHEVVTLWYRAPEILLGTKFYSTGV 187

  Fly   243 DMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDV--WPGVEELELYKSIELPKNQKR 305
            |:|..|||.:||..|..:..|::|..||..|.:...  |||.  ||||.:|..:|: :.|:.:..
  Fly   188 DIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLS--TPDETNWPGVTQLPDFKT-KFPRWEGT 249

  Fly   306 RVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFF 347
            .:.:.    :.:....:|:..:|..||..||.|..||.|.:|
  Fly   250 NMPQP----ITEHEAHELIMSMLCYDPNLRISAKDALQHAYF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 115/300 (38%)
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 116/302 (38%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 115/298 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.