DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Cdk12

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster


Alignment Length:351 Identity:153/351 - (43%)
Similarity:218/351 - (62%) Gaps:31/351 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLI 114
            :|.:|:||:||:|:|:|||:...| ..||:|||.:::|||||||||:|||:||:.|.|.|:|||.
  Fly   804 FEMIAQIGEGTYGQVYKARDHHTN-DMVALKKVRLEHEKEGFPITAVREIKILRQLNHRNIVNLH 867

  Fly   115 EICRTKATATNGYR---STFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNK 176
            ||...|..|.. :|   .:|||||::.:|||.|||.:..|.|:......:|:|||:||.|.|...
  Fly   868 EIVTDKQDAVE-FRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKKN 931

  Fly   177 ILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPP 241
            .||||:|.:|:|:...|.:|||||||||.::  .::.:..|||:|:||||||||||||:..|||.
  Fly   932 FLHRDIKCSNILMNNRGKVKLADFGLARLYN--ADDRERPYTNKVITLWYRPPELLLGEERYGPS 994

  Fly   242 VDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKRR 306
            :|:|..|||:.|::.:.|:.|.|.|..||..||::|||..|.|||.|.:|.|:.:::..|..:||
  Fly   995 IDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQKKTHRRR 1059

  Fly   307 VKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTAL--------NHDFFWTDPMPS--DLSKMLS 361
            ::|...  .......|||||:|.|||.|||.|:.||        |.|...|..:|:  |..::.|
  Fly  1060 LREDFE--FMPAPALDLLDKMLDLDPDKRITAEDALRSPWLRKINPDEMPTPQLPTWQDCHELWS 1122

  Fly   362 QHLQSMFEYLAQPRRSNQMRNYHQQL 387
            :            :|..|||...:.|
  Fly  1123 K------------KRRRQMREQQESL 1136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 144/307 (47%)
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 142/299 (47%)
S_TKc 804..1098 CDD:214567 142/299 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442449
Domainoid 1 1.000 253 1.000 Domainoid score I332
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D344403at33208
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R186
SonicParanoid 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.