DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Pitslre

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster

Alignment Length:386 Identity:143/387 (37%)
Similarity:208/387 (54%) Gaps:62/387 (16%)


  Fly    14 STPSNVGSSSSRTMS-----------LMEKQKYIEDYDFPYCDES-----------------NKY 50
            ::||:...|..|.|:           |.||||.:|: ..| ||:.                 .::
  Fly   496 ASPSSSTRSEERGMTQEQPEEKPEEKLKEKQKSLEE-QIP-CDDKGIPLPNYYPGVQGCRSVEEF 558

  Fly    51 EKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLIE 115
            :.:.:|.:||:|.|::|::|:.| :.||:|::.|:.||||||||:||||..|...:|.|:|.:.|
  Fly   559 QCLNRIEEGTYGVVYRAKDKRTN-EIVALKRLKMEKEKEGFPITSLREINTLLKGQHPNIVTVRE 622

  Fly   116 ICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVK---FSLGEIKKVMQQLLNGLYYIHSNKI 177
            |      .........::|.|:.||||..|:..|..:   |..||:|.:.||||..:.::|.|.|
  Fly   623 I------VVGSNMDKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLRAVAHLHDNWI 681

  Fly   178 LHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPV 242
            ||||:|.:|:|::..||||:.||||||.:..|    ..:||:.|||||||.|||||....|..|:
  Fly   682 LHRDLKTSNLLLSHKGILKVGDFGLAREYGSP----IKKYTSLVVTLWYRAPELLLCSPVYSTPI 742

  Fly   243 DMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSI--------EL 299
            |:|..|||.||.....|:..|.:|..:|..|.:..|:....:|||..||...|::        |.
  Fly   743 DVWSVGCIFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEKIWPGYTELPAVKNMLSQNSQFTEY 807

  Fly   300 PKNQKRRVKERLRPYVKDQT---GCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLS 357
            |.:|       ||.:.:::|   |..||..|||.|||:|:.||.||.|.||...|:|.|.|
  Fly   808 PVSQ-------LRKHFQEKTSEMGLSLLQGLLTYDPKQRLSADAALKHGFFKELPLPIDPS 861

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 128/341 (38%)
S_TKc 50..347 CDD:214567 124/311 (40%)
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 124/317 (39%)
PLN00009 555..854 CDD:177649 125/317 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111430102
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D925637at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.