DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Eip63E

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster


Alignment Length:399 Identity:136/399 - (34%)
Similarity:204/399 - (51%) Gaps:48/399 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAHMSHMLQQPSGSTPSNVGSSSSRTMSLMEKQKYIEDY--DFPYCDESNKYEKVAKIGQGTFGE 63
            |.:.||::.:|. ..|...............::|....:  |.|: .:...|.|:..:|:|::..
  Fly   156 MKYHSHVVMRPK-KPPRPKSEVFLNKQETHPRRKRFSAFGGDSPF-GKQEAYVKLEPLGEGSYAT 218

  Fly    64 VFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLIEICRTKATATNGYR 128
            |:|...|...:: ||:|::.: .|:||.|.||:||..:|:.|||.|:|.|.:|..|:.|.|    
  Fly   219 VYKGFSKLTYQR-VALKEIRL-QEEEGAPFTAIREASLLKELKHSNIVTLHDIVHTRETLT---- 277

  Fly   129 STFYLVFDFCEHDLA-------GLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAAN 186
                .||::...||:       |.|.:.||:..|       .|||.||.|.|..::||||:|..|
  Fly   278 ----FVFEYVNTDLSQYMEKHPGGLDHRNVRLFL-------FQLLRGLSYCHKRRVLHRDVKPQN 331

  Fly   187 VLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIM 251
            :||:..|.|||||||||||.|:|    .:.|::.|||||||||::|||...|...:||||.|||.
  Fly   332 LLISDCGELKLADFGLARAKSVP----SHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIF 392

  Fly   252 AEMWTRSPIMQG-NTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKRRVKE---RLR 312
            .||.|..|...| .....||..|.:|.|:.|.|.||||.....||..:|...:.|::..   ||.
  Fly   393 VEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKLGFYRPRKLGHNFPRLY 457

  Fly   313 PYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDP-----MPSDLSKMLSQHLQSMFEYLA 372
            ..::.:|   :.:..|.|:|::|:.||.||.|.:|...|     :|.:.|....:.:|    ...
  Fly   458 DIIEGET---IANGFLQLNPEQRLGADDALQHPYFAQLPKKLYELPDETSIFTVEGVQ----LYT 515

  Fly   373 QPRRSNQMR 381
            :|.|.|:.:
  Fly   516 EPNRQNKXK 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 122/322 (38%)
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 121/312 (39%)
STKc_PCTAIRE_like 204..489 CDD:270835 120/308 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.