DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Cdk4

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster

Alignment Length:331 Identity:117/332 (35%)
Similarity:185/332 (56%) Gaps:28/332 (8%)


  Fly    30 MEKQKYIEDYDFPYCDESNKYEKVAKIGQGTFGEVFKAREK-KGNKKFVAMKKVLMDNEKEGFPI 93
            :::||..:...|...|..| |:::..||:|.:|.|::||:. .||  .||:|||.:...:.|.|:
  Fly     7 LKRQKMSQAKKFGDGDPFN-YQELNIIGEGAYGTVYRARDVITGN--IVALKKVRISLNENGVPM 68

  Fly    94 TALREIRILQLL---KHENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNM-NVKFS 154
            :.||||.:|:.|   .|.|:|.|.|:|  :....:| :....|||:..|.||:.|:..: ....|
  Fly    69 STLREISLLKQLNASNHANIVKLYEVC--QFLERDG-QLLILLVFEHVEQDLSDLIDRLPKSGMS 130

  Fly   155 LGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTN 219
            ...|:::.::||.|:.::||::|:|||:|..|:|::..|.||:||||||:.:.     |:.:.|:
  Fly   131 PPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTYG-----SEMKLTS 190

  Fly   220 RVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDV 284
            .|||||||.||:||. :.|...||:|.|.||:.||:.|..:..|.:|:.||..|.:|.|..|...
  Fly   191 VVVTLWYRAPEVLLA-QPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQ 254

  Fly   285 WPGVEELELYKSIELPKNQKRRVKE---RLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDF 346
            ||....:.|.   ..|:...:|.|:   .|..|..     |||:|:|:.|...|..|...|.||:
  Fly   255 WPQTISVALE---HFPQRHPKRPKDFCPHLCKYAD-----DLLNKMLSYDLHLRPSALACLEHDY 311

  Fly   347 FWTDPM 352
            |..:|:
  Fly   312 FQQEPL 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 113/318 (36%)
S_TKc 50..347 CDD:214567 110/305 (36%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 110/305 (36%)
S_TKc 26..312 CDD:214567 110/305 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111424170
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.