| Sequence 1: | NP_477226.2 | Gene: | Cdk9 / 37586 | FlyBaseID: | FBgn0019949 | Length: | 404 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_609603.1 | Gene: | Pk34A / 34705 | FlyBaseID: | FBgn0028410 | Length: | 392 | Species: | Drosophila melanogaster | 
| Alignment Length: | 339 | Identity: | 91/339 - (26%) | 
|---|---|---|---|
| Similarity: | 151/339 - (44%) | Gaps: | 70/339 - (20%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    56 IGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRIL-QLLKHENVVNLIEICRT 119 
  Fly   120 KATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFS-------LGEIKKVMQQLLNGLYYIHSNKI 177 
  Fly   178 LHRDMKAANVLI-TKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPP 241 
  Fly   242 VDMWGAGCIMAEMWTRSPIMQGNT-EQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKR 305 
  Fly   306 RVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKMLSQHLQSMFEY 370 
  Fly   371 LAQPRRSNQMRNYH 384 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Cdk9 | NP_477226.2 | STKc_CDK9 | 37..347 | CDD:270848 | 79/300 (26%) | 
| Pk34A | NP_609603.1 | STKc_GSK3 | 39..334 | CDD:271039 | 91/339 (27%) | 
| S_TKc | 45..328 | CDD:214567 | 90/337 (27%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45442374 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24056 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||