DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Pk34A

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster


Alignment Length:339 Identity:91/339 - (26%)
Similarity:151/339 - (44%) Gaps:70/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRIL-QLLKHENVVNLIEICRT 119
            ||.|:||.|::|...: :::.||:|:.|.:      |..:..|..|: ||..|.|:|.||    .
  Fly    50 IGSGSFGRVYQAHVNE-SEEIVAVKQTLYN------PKLSQGEAEIMGQLKDHNNIVRLI----M 103

  Fly   120 KATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFS-------LGEIKKVMQQLLNGLYYIHSNKI 177
            .::.:.|:.|..|::. ..|:....||..:|...:       |..::.:..|:..||.|:|...|
  Fly   104 HSSVSLGFPSVDYVLL-VMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLHLLGI 167

  Fly   178 LHRDMKAANVLI-TKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPP 241
            .|||:|..|:|| .:..:|||:|||.|:.. :|:..|.:...:|:    ||.|||..|...|...
  Fly   168 SHRDVKPENLLIDNQKMVLKLSDFGSAKLL-VPQEPSISYICSRL----YRAPELFAGYELYSCA 227

  Fly   242 VDMWGAGCIMAEMWTRSPIMQGNT-EQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKR 305
            ||:|.|||::||:....|:...:. :::||..|..:.|:      .|:|.               
  Fly   228 VDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGT------DGLER--------------- 271

  Fly   306 RVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKMLSQHLQSMFEY 370
                  .|.:..:.|       .:|.|:     .|..:.::.....:|.||..:|:    |.|.|
  Fly   272 ------APEILSKCG-------NSLHPR-----TTRPSWNYLLNTAVPQDLCGLLN----SCFIY 314

  Fly   371 LAQPRRSNQMRNYH 384
            .|..|.|..|...|
  Fly   315 EAAARISPMMACSH 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 79/300 (26%)
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 91/339 (27%)
S_TKc 45..328 CDD:214567 90/337 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.