DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and cdk9

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_997756.1 Gene:cdk9 / 321602 ZFINID:ZDB-GENE-030131-321 Length:393 Species:Danio rerio

Alignment Length:401 Identity:283/402 (70%)
Similarity:323/402 (80%) Gaps:11/402 (3%)


  Fly     7 MLQQPSGSTPSNVGSSSSRTMSLMEKQKYIEDYDFPYCDESNKYEKVAKIGQGTFGEVFKAREKK 71
            |.:..:||  |..|....|..::|  .||.:..:||:|||.:||||:||||||||||||||:.::
Zfish     1 MQRDKTGS--SGGGEKPDRETAIM--SKYYDGVEFPFCDEFSKYEKLAKIGQGTFGEVFKAKHRQ 61

  Fly    72 GNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLIEICRTKATATNGYRSTFYLVFD 136
            ..|| ||:|||||:||||||||||||||:||||||||||||||||||||||..|.|:.:.|||||
Zfish    62 TGKK-VALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKATQFNRYKGSIYLVFD 125

  Fly   137 FCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFG 201
            ||||||||||||.||||:|.|||:|||.|||||||||.||||||||||||||||:.|:|||||||
Zfish   126 FCEHDLAGLLSNANVKFTLAEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFG 190

  Fly   202 LARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTE 266
            ||||||:.||...||||||||||||||||||||:|:||||:|:||||||||||||||||||||||
Zfish   191 LARAFSLAKNSQGNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTE 255

  Fly   267 QQQLTFISQLCGSFTPDVWPGVE-ELELYKSIELPKNQKRRVKERLRPYVKDQTGCDLLDKLLTL 330
            |.|||.|||||||.||:|||||: :.|||:.:||||.|||:||:||:.||||....||:||||.|
Zfish   256 QHQLTLISQLCGSITPEVWPGVDKKYELYQKMELPKGQKRKVKDRLKAYVKDPYALDLIDKLLVL 320

  Fly   331 DPKKRIDADTALNHDFFWTDPMPSDLSKMLSQHLQSMFEYLAQPRRSNQMRNYHQQLTTMNQKPQ 395
            ||.:|||:|.||||||||:|||||||..|||.|..|||||||.|||...|   .||....|:.|.
Zfish   321 DPAQRIDSDDALNHDFFWSDPMPSDLKNMLSTHNTSMFEYLAPPRRRGHM---PQQPANQNRNPA 382

  Fly   396 DNSM--IDRVW 404
            ..|.  .|||:
Zfish   383 TTSQSEFDRVF 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 242/311 (78%)
S_TKc 50..347 CDD:214567 236/298 (79%)
cdk9NP_997756.1 STKc_CDK9 27..337 CDD:270848 242/311 (78%)
S_TKc 40..337 CDD:214567 236/298 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230310507
eggNOG 1 0.900 E1_KOG0669
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H55566
Inparanoid 1 1.050 561 1.000 Inparanoid score I1041
OMA 1 1.010
OrthoDB 1 1.010 D344403at33208
OrthoFinder 1 1.000 FOG0000559
OrthoInspector 1 1.000 T1051886
orthoMCL 1 0.900 OOG5_130531
Panther 1 1.100 LDO PTHR24056
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R186
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.