DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and srb10

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_593389.2 Gene:srb10 / 2541900 PomBaseID:SPAC23H4.17c Length:369 Species:Schizosaccharomyces pombe

Alignment Length:340 Identity:114/341 (33%)
Similarity:176/341 (52%) Gaps:57/341 (17%)


  Fly    50 YEKVAKIGQGTFGEVFKAREKKGN-------KKFVAMKKVLMDN-EKEGFPITALREIRILQLLK 106
            |:.:..|..||:|:|:||.....|       |||.|..|.:..| ::.|...:|:||:.:.:.::
pombe     5 YKIIGFISSGTYGKVYKAVSSNSNDKRLFAIKKFKAESKQVSSNAQQTGVSQSAIREMMLCREIQ 69

  Fly   107 HENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLL------SNMNVKFSLGEIKKVMQQL 165
            |||:|:|:::.....|.:        :||::.||||..::      ....:..|:  :|.::.|:
pombe    70 HENIVSLVQVLLKDGTIS--------MVFEYAEHDLLQIIHFHSRSRTRQIPPSI--LKSILWQI 124

  Fly   166 LNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIP--KNESKNRYTNRVVTLWYRP 228
            :||:.|:|.|.|:|||:|.||::||..|.:|:.|.||.|....|  ...|.:|.   |||:|||.
pombe   125 INGVAYLHENWIMHRDLKPANIMITATGKVKIGDLGLGRLIRDPILPFYSSDRV---VVTIWYRA 186

  Fly   229 PELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNT-----------EQQQLTFISQLCGSFTP 282
            ||||||..:|.|.:|:|..|||..||...||:.:|:.           :..|:..|.:|.|:.|.
pombe   187 PELLLGAHDYTPAIDVWAIGCIYGEMLALSPLFKGDEIKMEDKKVVPFQSTQMLRIMELLGTPTE 251

  Fly   283 DVWPGVEELELYKSIE----------LPKNQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRID 337
            :.|||::....|..:.          ||: ..:.||.|      |..|.|||.|:|..|||.||.
pombe   252 ERWPGLKNYPEYYQLSSFEVRYWNNLLPQ-WYQTVKNR------DPQGLDLLMKMLQYDPKSRIT 309

  Fly   338 ADTALNHDFFWTDPM 352
            |..||.|.||.:|.:
pombe   310 AKQALEHVFFTSDKL 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 112/334 (34%)
S_TKc 50..347 CDD:214567 112/334 (34%)
srb10NP_593389.2 PTZ00024 1..324 CDD:240233 114/339 (34%)
STKc_CDK8_like 4..319 CDD:270834 112/334 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.