DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and lsk1

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_594393.1 Gene:lsk1 / 2541672 PomBaseID:SPAC2F3.15 Length:593 Species:Schizosaccharomyces pombe

Alignment Length:351 Identity:141/352 (40%)
Similarity:210/352 (60%) Gaps:31/352 (9%)


  Fly    36 IEDYDFPYCDESNKYEKVAKIGQGTFGEVFKA-REKKGNKKFVAMKKVLMDNEKEGFPITALREI 99
            |..|.:|    ...|||:.:||:||:|:|:|| ....|:  .||:|::.::.||:|||||.:||:
pombe   267 IYTYTYP----KPAYEKIDQIGEGTYGKVYKAINTVTGD--LVALKRIRLEQEKDGFPITTVREV 325

  Fly   100 RILQLLKHENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQ 164
            :|||.|:|:|:|.|:||...|        |:.|:||::.:|||.|:|.|..:.|:.|.||.:.:|
pombe   326 KILQRLRHKNIVRLLEIMVEK--------SSVYMVFEYMDHDLTGVLLNSQLHFTPGNIKHLSKQ 382

  Fly   165 LLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPP 229
            :...|.|:|...:||||:|.:|:|:..:|.||.|||||||..:..|:.:   |||||:|||:|||
pombe   383 IFEALAYLHHRGVLHRDIKGSNILLNNNGDLKFADFGLARFNTSSKSAN---YTNRVITLWFRPP 444

  Fly   230 ELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDV--WPGVEELE 292
            |||||:..|...||:|.||||:.|::|..|..||..|..||..|..:.|  ||||  ||.|:.|.
pombe   445 ELLLGETAYDTAVDIWSAGCIVMELFTGKPFFQGRDEISQLEVIYDMMG--TPDVHSWPEVKNLP 507

  Fly   293 LYKSIELPKNQKRR----VKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMP 353
            .|:.::..:.:|.|    .||.|.|     ...||..|||.|:|..|..|...|.|::|.::..|
pombe   508 WYELLKPVEEKKSRFVETFKEILSP-----AAIDLCQKLLALNPFCRPSAHETLMHEYFTSESPP 567

  Fly   354 SDLSKMLSQHLQSMFEYLAQPRRSNQ 379
            .:.:.:|.....|..|:.::.|:|.:
pombe   568 PEPAVILKNMQGSWHEWESKKRKSKR 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 133/317 (42%)
S_TKc 50..347 CDD:214567 131/304 (43%)
lsk1NP_594393.1 STKc_CDK9_like 277..561 CDD:270832 131/304 (43%)
S_TKc 277..561 CDD:214567 131/304 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R186
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.