DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and ppk23

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_595739.1 Gene:ppk23 / 2540799 PomBaseID:SPBC18H10.15 Length:398 Species:Schizosaccharomyces pombe

Alignment Length:350 Identity:136/350 (39%)
Similarity:192/350 (55%) Gaps:36/350 (10%)


  Fly    25 RTMSLMEKQKYIEDY--------------DFPYCDESNKYEKVAKIGQGTFGEVFKAREKKGNKK 75
            |...::|:::..|:.              :...|:..:.||.:.||.:|::|.|::..:|..| .
pombe    35 RKRKILEEEEKAEERNIDACRLYLMGNTPELKSCNSIDDYEILEKIEEGSYGIVYRGLDKSTN-T 98

  Fly    76 FVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLIEICRTKATATNGYRSTFYLVFDFCEH 140
            .||:||:..|....|||||:||||..|..::|:|:|.|.::...|..      ...|||.:|.||
pombe    99 LVALKKIKFDPNGIGFPITSLREIESLSSIRHDNIVELEKVVVGKDL------KDVYLVMEFMEH 157

  Fly   141 DLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARA 205
            ||..||.||...|...|:|.:|.|||....::|.:..||||:|.:|:|:...|.:||||||||| 
pombe   158 DLKTLLDNMPEDFLQSEVKTLMLQLLAATAFMHHHWYLHRDLKPSNLLMNNTGEIKLADFGLAR- 221

  Fly   206 FSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQL 270
               |.:|.|:..|..|||||||.||||||..:||..:|||..|||.|||.||:|:..|.:|..||
pombe   222 ---PVSEPKSSLTRLVVTLWYRAPELLLGAPSYGKEIDMWSIGCIFAEMITRTPLFSGKSELDQL 283

  Fly   271 TFISQLCGSFTPDVWPGVEELELYKSIE---LPKNQKRRVKERLRPYVKDQTG--CDLLDKLLTL 330
            ..|..|.|..|.:.||....|.....|:   :|.:.|      :|..:.:.||  .|||::||:|
pombe   284 YKIFNLLGYPTREEWPQYFLLPYANKIKHPTVPTHSK------IRTSIPNLTGNAYDLLNRLLSL 342

  Fly   331 DPKKRIDADTALNHDFFWTDPMPSD 355
            :|.|||.|..||.|.:|:..|.|.|
pombe   343 NPAKRISAKEALEHPYFYESPRPKD 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 130/329 (40%)
S_TKc 50..347 CDD:214567 128/302 (42%)
ppk23NP_595739.1 STKc_CDC2L1 68..359 CDD:173741 129/308 (42%)
PLN00009 71..361 CDD:177649 129/307 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.