DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and cdk9

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_595616.1 Gene:cdk9 / 2540239 PomBaseID:SPBC32H8.10 Length:591 Species:Schizosaccharomyces pombe

Alignment Length:383 Identity:155/384 (40%)
Similarity:227/384 (59%) Gaps:20/384 (5%)


  Fly    22 SSSRTMSLMEKQKYIEDYDFPYCDESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDN 86
            |:.|.:.::.|..::.      |.....|..:.|:|:||||||:|::.:|..|.: |:|::||..
pombe    14 SARRKLDVVPKLHFVG------CSHLTDYHLMEKLGEGTFGEVYKSQRRKDGKVY-ALKRILMHT 71

  Fly    87 EKEGFPITALREIRILQLLKHENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNV 151
            |||||||||:|||:||:.:||||::.|.::...:|...:..|.:.|:|..:.:|||:|||.|.:|
pombe    72 EKEGFPITAIREIKILKSIKHENIIPLSDMTVVRADKKHRRRGSIYMVTPYMDHDLSGLLENPSV 136

  Fly   152 KFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKN- 215
            ||:..:||..|:||..|..|:|...|||||:||||:||..|||||:|||||||..:.....:|| 
pombe   137 KFTEPQIKCYMKQLFAGTKYLHDQLILHRDLKAANLLIDNHGILKIADFGLARVITEESYANKNP 201

  Fly   216 --------RYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTF 272
                    .||..|||.|||.||||||:|.|...:|||..|||||||:...||:||:::..||..
pombe   202 GLPPPNRREYTGCVVTRWYRSPELLLGERRYTTAIDMWSVGCIMAEMYKGRPILQGSSDLDQLDK 266

  Fly   273 ISQLCGSFTPDVWPGVEELELYKSIELPKNQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRID 337
            |.:||||.|....|..|:|...:.:....:..|.::.....:.|:.|  .|...:|||:|.:|:.
pombe   267 IFRLCGSPTQATMPNWEKLPGCEGVRSFPSHPRTLETAFFTFGKEMT--SLCGAILTLNPDERLS 329

  Fly   338 ADTALNHDFFWTDPMPSDLSKMLSQHLQSMFEYLAQPRRSNQMRNYHQQLTTMNQKPQ 395
            |..||.|::|.|.|.|::.|::  |...:..||..:.:|..:..|.|....|.|.|.|
pombe   330 ASMALEHEYFTTPPYPANPSEL--QSYSASHEYDKRRKREQRDANSHAFEQTANGKRQ 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 137/319 (43%)
S_TKc 50..347 CDD:214567 136/306 (44%)
cdk9NP_595616.1 STKc_BUR1 27..339 CDD:270849 137/321 (43%)
S_TKc 36..339 CDD:214567 136/306 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H55566
Inparanoid 1 1.050 278 1.000 Inparanoid score I668
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000559
OrthoInspector 1 1.000 T1124339
orthoMCL 1 0.900 OOG5_130531
Panther 1 1.100 LDO PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R186
TreeFam 1 0.960
99.040

Return to query results.
Submit another query.