DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cdk9 and Cdk10

Sequence 1:NP_477226.2 Gene:Cdk9 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_919428.1 Gene:Cdk10 MGIID:2448549 Length:360 Species:Mus musculus

Alignment Length:312 Identity:127/313 (41%)
Similarity:186/313 (59%) Gaps:13/313 (4%)


  Fly    44 CDESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHE 108
            |....::||:.:||:||:|.|::||:.: ..:.||:|||.||.||:|.||::||||.:|..|:|.
Mouse    33 CRSVKEFEKLNRIGEGTYGIVYRARDTQ-TDEIVALKKVRMDKEKDGIPISSLREITLLLRLRHP 96

  Fly   109 NVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIH 173
            |:|.|.|:      ....:..:.:||..:||.|||.||.||...||..::|.:|.|:|.||.|:|
Mouse    97 NIVELKEV------VVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIMLQVLRGLQYLH 155

  Fly   174 SNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNY 238
            .|.|:|||:|.:|:|:|..|.:|.||||||||:.:|...    .|.:|||||||.||||||....
Mouse   156 RNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKP----MTPKVVTLWYRAPELLLGTTTQ 216

  Fly   239 GPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQ 303
            ...:|||..|||:||:....|::.|.:|..|:..|.||.|:.:.::|||..:|.|.....|.|..
Mouse   217 TTSIDMWAVGCILAELLAHKPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLAGQYSLRKQP 281

  Fly   304 KRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSD 355
            ...:|.:. |:: .:.|..||:.|...|||||..:...|...:|...|:|.:
Mouse   282 YNNLKHKF-PWL-SEAGLRLLNFLFMYDPKKRATSGDCLESSYFKEKPLPCE 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 124/303 (41%)
S_TKc 50..347 CDD:214567 123/297 (41%)
Cdk10NP_919428.1 STKc_CDK10 31..339 CDD:173742 127/313 (41%)
PTZ00024 43..336 CDD:240233 124/303 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.