DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Cdk11b

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_031687.2 Gene:Cdk11b / 12537 MGIID:88353 Length:784 Species:Mus musculus

Alignment Length:412 Identity:145/413 (35%)
Similarity:216/413 (52%) Gaps:55/413 (13%)


  Fly    11 PSGSTPSNVGS--SSSRTMSLMEKQKYIEDYDFPY---CDESNKYEKVAKIGQGTFGEVFKAREK 70
            |..|.|:. |.  ..|..:|.:|.::.:..| .|.   |....:::.:.:|.:||:|.|::|::|
Mouse   385 PQSSAPTE-GDYVPDSPALSPIELKQELPKY-LPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDK 447

  Fly    71 KGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLIEICRTKATATNGYRSTFYLVF 135
            | ..:.||:|::.|:.||||||||:||||..:...:|.|:|.:.||      .........|:|.
Mouse   448 K-TDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREI------VVGSNMDKIYIVM 505

  Fly   136 DFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADF 200
            ::.||||..|:..|...|..||:|.:|.|||:|:.::|.|.|||||:|.:|:|::..||||:.||
Mouse   506 NYVEHDLKSLMETMKQPFLPGEVKTLMIQLLSGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDF 570

  Fly   201 GLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNT 265
            ||||.:..|    ...||..|||||||.||||||.:.|...||||..|||..|:.|:.|:..|.:
Mouse   571 GLAREYGSP----LKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 631

  Fly   266 EQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKRRVKERLRPYVKDQTGCDLLDKLLTL 330
            :..|:..|.:..|:.:..:|||..:|...|.:...:.....:::|....:.|| |.||::|.||.
Mouse   632 DIDQINKIFKDLGTPSEKIWPGYNDLPAVKKMTFSEYPYNNLRKRFGALLSDQ-GFDLMNKFLTY 695

  Fly   331 DPKKRIDADTALNHDFFWTDPMPSDLSKMLSQHLQSMFEYLAQPRRSNQMR-------------- 381
            .|.:||:|:..|.|::|...|:|.|         .|||.  ..|.:|.|.|              
Mouse   696 YPGRRINAEDGLKHEYFRETPLPID---------PSMFP--TWPAKSEQQRVKRGTSPRPPEGGL 749

  Fly   382 NYHQ-----------QLTTMNQ 392
            .|.|           .|||.||
Mouse   750 GYSQLGDDDLKETGFHLTTTNQ 771

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 120/313 (38%)
S_TKc 50..347 CDD:214567 117/297 (39%)
Cdk11bNP_031687.2 STKc_CDC2L1 421..712 CDD:173741 118/303 (39%)
PLN00009 424..714 CDD:177649 118/302 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.