DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Cdk9

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_570930.1 Gene:Cdk9 / 107951 MGIID:1328368 Length:372 Species:Mus musculus

Alignment Length:364 Identity:262/365 (72%)
Similarity:302/365 (83%) Gaps:6/365 (2%)


  Fly    34 KYIEDYDFPYCDESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALRE 98
            |..:..:.|:|||..||||:||||||||||||||:.::..:| ||:|||||:|||||||||||||
Mouse     3 KQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRQTGQK-VALKKVLMENEKEGFPITALRE 66

  Fly    99 IRILQLLKHENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQ 163
            |:|||||||||||||||||||||:..|..:.:.|||||||||||||||||:.|||:|.|||:|||
Mouse    67 IKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQ 131

  Fly   164 QLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRP 228
            .|||||||||.||||||||||||||||:.|:|||||||||||||:.||...||||||||||||||
Mouse   132 MLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRP 196

  Fly   229 PELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELEL 293
            ||||||:|:||||:|:|||||||||||||||||||||||.||..|||||||.||:|||.|::.||
Mouse   197 PELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDKYEL 261

  Fly   294 YKSIELPKNQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSK 358
            ::.:||.|.|||:||:||:.||:|....||:||||.|||.:|||:|.||||||||:|||||||..
Mouse   262 FEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKG 326

  Fly   359 MLSQHLQSMFEYLAQPRR-----SNQMRNYHQQLTTMNQ 392
            |||.||.|||||||.|||     :.|..|..:...|.||
Mouse   327 MLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQ 365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 232/310 (75%)
S_TKc 50..347 CDD:214567 227/297 (76%)
Cdk9NP_570930.1 STKc_CDK9 6..315 CDD:270848 231/309 (75%)
T-loop. {ECO:0000250} 166..191 20/25 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230327606
eggNOG 1 0.900 E1_KOG0669
Hieranoid 1 1.000
Homologene 1 1.000 H55566
Inparanoid 1 1.050 536 1.000 Inparanoid score I1174
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000559
OrthoInspector 1 1.000 T1082519
orthoMCL 1 0.900 OOG5_130531
Panther 1 1.100 LDO PTHR24056
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R186
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.