DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and cdk12

DIOPT Version :8

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_003200579.2 Gene:cdk12 / 100149834 ZFINID:ZDB-GENE-081104-294 Length:1293 Species:Danio rerio

Alignment Length:342 Identity:148/343 (43%)
Similarity:209/343 (61%) Gaps:9/343 (3%)


  Fly    48 NKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVN 112
            :|::.:..||:||:|:|:||:: |...:.||:|||.:|||||||||||:|||:||:.|.|.:|||
Zfish   673 DKFDIIGIIGEGTYGQVYKAKD-KDTGELVALKKVRLDNEKEGFPITAIREIKILRQLNHRSVVN 736

  Fly   113 LIEICRTKATATN--GYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSN 175
            :.||...|..|.:  ..:..|||||::.:|||.|||.:..|.||...::..|:||:.||.|.|..
Zfish   737 MKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVSFSHEHVQSFMRQLMEGLDYCHKK 801

  Fly   176 KILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGP 240
            ..||||:|.:|:|:...|.:|||||||||.::   :|....|||:|:||||||||||||:..|.|
Zfish   802 NFLHRDIKCSNILLNNSGQIKLADFGLARLYN---SEESRPYTNKVITLWYRPPELLLGEERYSP 863

  Fly   241 PVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKR 305
            .:|:|..|||:.|::|:.||.|.|.|..||..||:||||..|..||.|..|..:.::...|..:|
Zfish   864 AIDVWSCGCILGELFTKKPIFQANQELLQLELISRLCGSPCPAAWPDVIRLPYFNTMRPKKQYRR 928

  Fly   306 RVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKMLSQHLQSMFEY 370
            |::|...  .......||||.:|||||.:|..|:.||...|. .|..|:.:......|.|...|.
Zfish   929 RLREEFS--FLPTPALDLLDHMLTLDPSRRCTAEQALASQFL-CDVEPNKMPPPDLPHWQDCHEL 990

  Fly   371 LAQPRRSNQMRNYHQQL 387
            .::.||..:.....:.|
Zfish   991 WSKKRRRQRQSGVSEDL 1007

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 140/301 (47%)
S_TKc 50..347 CDD:214567 139/299 (46%)
cdk12XP_003200579.2 STKc_CDK12 667..968 CDD:270847 140/301 (47%)
S_TKc 675..968 CDD:214567 139/299 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D344403at33208
OrthoFinder 1 1.000 FOG0000559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R186
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.