DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps20 and VPS20

Sequence 1:NP_611686.2 Gene:Vps20 FlyBaseID:FBgn0034744 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_013794.1 Gene:VPS20 SGDID:S000004682 Length:221 Species:Saccharomyces cerevisiae

Alignment Length:209 Identity:69/210 (33%)
Similarity:124/210 (59%) Gaps:13/210 (6%)


  Fly    10 KKTAPSRITDQDKAVLQLKQQRDRLKQYQKRIETQL--ENDRL--LARKCLQQGRKD-RAKLLLR 69
            :|::...||..|:|:|::|:.:|.:.::.:|.:..:  |..:|  |.||..:..:.: :.:.||:
Yeast     3 QKSSKVHITKTDRAILEVKRSKDEIHKFTRRTDNLILVEKSQLKDLIRKNPENYKSNMKVRFLLK 67

  Fly    70 KKKYQESLLTNADKQLENLEKLAADIEFAQVEMKVLDGLKAGNAALKKVHEMLDIDEVERIMDET 134
            :..|||.||..|..||.|||.:.:.:||..||.:.::|||.||..|||:::  :...|:.:||:.
Yeast    68 RIHYQEHLLQQASDQLINLENMVSTLEFKMVEKQFINGLKNGNEILKKLNK--EFSNVDELMDDV 130

  Fly   135 REGIEKQQEIDAILTDVL--TTQDEEDVLAELDALEAE--EEQQKGAQLPDVP-TEDLPIPAEIE 194
            ::.|..|.||:..|:..|  |:..|:|:..||||||:|  .|:...|::.::| ||.||...:.|
Yeast   131 QDQIAYQNEINETLSRSLVGTSNYEDDLDKELDALESELNPEKMNNAKVANMPSTEGLPSLPQGE 195

  Fly   195 SVEEPAKTK-ATKK 207
            ..|:..:.: ||::
Yeast   196 QTEQKEREEFATEE 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps20NP_611686.2 Snf7 22..186 CDD:281366 59/174 (34%)
VPS20NP_013794.1 Snf7 15..186 CDD:308778 58/173 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2910
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I1448
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003133
OrthoInspector 1 1.000 T1136882
orthoMCL 1 0.900 OOG5_128494
Panther 1 1.100 LDO PTHR22761
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5973
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.