DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps20 and Vps60

Sequence 1:NP_611686.2 Gene:Vps20 FlyBaseID:FBgn0034744 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001261994.1 Gene:Vps60 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster

Alignment Length:239 Identity:57/240 (24%)
Similarity:106/240 (44%) Gaps:47/240 (20%)


  Fly     1 MGALFGK-TSKKTAPS----------RITDQDKAVLQLKQQRDRLKQYQKRIETQLENDRLLARK 54
            |..|||: ..|:..||          |.|:.::.:..|:.:   |::|::::....|..   |:.
  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAE---LRKYREQMSKMREGP---AKN 59

  Fly    55 CLQQGRKDRAKLLLRKKKYQESL--LTNADKQLENLEKLAADIEFAQVEMKVL-DGLKAGNAALK 116
            .::|   ...::|.:||.|::..  |.|....:|.....|..::..|..:..: ||:|    .:|
  Fly    60 SVKQ---KALRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVK----QMK 117

  Fly   117 KVHEMLDIDEVERIMDETREGIEKQQEIDAIL--TDVLTTQDEEDVLAELDALEAE--------- 170
            ..::.::||::|.|.|:..:..|:..|:...|  |..:...|::|:.||||||..|         
  Fly   118 TEYKKINIDQIEDIQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSY 182

  Fly   171 -EEQQKGAQLPD-VPTEDLPIPAE--IESVE-----EPAKTKAT 205
             ::..|..:.|. .|..|..:|.:  ||:.|     .|...|.|
  Fly   183 LDDVVKAPEAPSREPGADSIVPGKSTIETDEFGLPKIPTSLKTT 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps20NP_611686.2 Snf7 22..186 CDD:281366 40/180 (22%)
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 47/202 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22761
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.