DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dnr1 and CG34347

Sequence 1:NP_001261137.1 Gene:dnr1 FlyBaseID:FBgn0260866 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001097989.2 Gene:CG34347 FlyBaseID:FBgn0085376 Length:1517 Species:Drosophila melanogaster

Alignment Length:550 Identity:104/550 (19%)
Similarity:172/550 (31%) Gaps:223/550 (41%)


  Fly     5 VNLPNGTQQAVKWDPKANGQECLEKVCRAMNIICEMEYFGLEHWTPNQKESQTRQWINLRNRLSG 69
            :||.:.|:...:......||..|:.|...:|:| |..|||:.:   ..:|:|| .|::..:|:|.
  Fly    15 INLLDETEFIHEIKDDLPGQALLDVVFARLNLI-ETSYFGIRY---IDEENQT-HWLDPASRISR 74

  Fly    70 DSGSSGSGIQLMLALRVKFWV--PVHFILQESVRNLFYMQARRDLLEGRLTAPDWSGAAKLAALL 132
            ..........|...  |||:.  |.. :|:|..|...::|.::|:|:|||... :..||:|.|.:
  Fly    75 QLKPKSDPYDLYFG--VKFYAADPCK-LLEEITRYQLFLQVKQDVLQGRLPVA-FELAAELGAFV 135

  Fly   133 CQADGLRFNESSLKADCPMRMRRELAQQQQQQQQQAQQHRLEQQRKEKEHVLSFKKRRLSKQKSM 197
            .|:                    ||..             .:|:|..|.:|..|:          
  Fly   136 VQS--------------------ELGD-------------YDQRRHSKGYVSEFR---------- 157

  Fly   198 EHIEVCTLPAASTTSCSLQPSPSASASASASASASASASTSACSQTHSNSSSSSPSNSSSQTGLD 262
                             |.|:.|             :...:..|:.|......|||::.      
  Fly   158 -----------------LLPNQS-------------NELETRVSELHQQLKGMSPSSAE------ 186

  Fly   263 ERLASNPLRVYEEYFMQPSCEGEPPADYLRQIAVEHGKLAKLQMSLKTAKYWLLKSIQDLEG--- 324
                                     .:||.::.                  |     .|:.|   
  Fly   187 -------------------------LNYLDKVK------------------W-----HDMYGVDL 203

  Fly   325 ---YGE---ELFSGVTTNESATRCDIAVGAHGITVCRGGEKQSIP---FGAIAAAKSLRRTFKLE 380
               .||   |.|.|:|.:             ||.|.|  .|.::.   :..||......|.|.|.
  Fly   204 HPVLGEDSVEYFLGLTPS-------------GIVVLR--NKTTVAHYYWPRIAKVYYKGRYFMLR 253

  Fly   381 YVDDHNDRKELE---IKLPKQPIAAGLYRSITERHAFYVCDKVRGVVTNQFTRDLKGTIASMFME 442
            ..|     |.|.   .:.|::.....|:|...|.|||:...:|..:.::|      ...|.:|  
  Fly   254 ISD-----KNLSTYGFETPRKSACKHLWRCCVEHHAFFRQVRVAPLPSSQ------SHAADLF-- 305

  Fly   443 NTELGKRYVFDIQH---------------------TCREVHDQARRTLHE-------------RG 473
              :||.|:    :|                     |......|.||.:.:             ..
  Fly   306 --QLGSRF----RHSRPDKQTEKDALSAGRSPPAFTRTPSKRQPRRVIDDFFNSNGNGNGNGNGN 364

  Fly   474 GDLVAEGAEGCSAVAGG--LGASAVGEPGV 501
            |:....|..|...:.||  :|...:.:||:
  Fly   365 GNGHGHGGSGAGTLGGGSHMGNRPLPQPGM 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dnr1NP_001261137.1 B41 3..>143 CDD:214604 38/140 (27%)
FERM_N 5..67 CDD:286467 18/62 (29%)
FERM_M 93..>143 CDD:278785 14/50 (28%)
FERM_C_MYLIP_IDOL 325..435 CDD:270016 28/119 (24%)
zf-C3HC4_3 544..589 CDD:290631
CG34347NP_001097989.2 B41 13..204 CDD:214604 58/325 (18%)
FERM_N 15..77 CDD:286467 19/67 (28%)
FERM_M 98..204 CDD:278785 34/235 (14%)
FERM_C_NBL4_NBL5 200..287 CDD:270007 27/107 (25%)
FA 303..344 CDD:285894 7/49 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23280
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.