DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and khdrbs2

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001072215.1 Gene:khdrbs2 / 779662 XenbaseID:XB-GENE-490722 Length:345 Species:Xenopus tropicalis

Alignment Length:349 Identity:115/350 (33%)
Similarity:172/350 (49%) Gaps:72/350 (21%)


  Fly    74 QKYMQELMTERSRMENHFPLAVKLIDEALERVQ--LNGRIPTRDQYADVYQQRTIKLSQKVHVPI 136
            :||:.|||.|:..::..|..|::|:||.:.:.|  ...:.....:|.|:...:.||||::|.:|:
 Frog     4 EKYLPELMAEKDSLDPSFVHAMRLLDEEIVKFQDSEGNKEDGEKKYLDIISNKNIKLSERVLIPV 68

  Fly   137 KD-KKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHV 200
            |. .|||:|||||||:||||:||||||..|:.|||:.||:|:.:|||||.|.:||:|||:..|||
 Frog    69 KQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKIKEEELRKSDEAKHAHLSDELHV 133

  Fly   201 EVSTIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYREL-----MEDPEAAKKLTLRQLQQQ 260
            .:...|||.|||:|:::||.||:::|.||.:|:|||||.|||     .:|.|..|....|.::..
 Frog   134 LLEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSDDSERGKGTRGRGIRVP 198

  Fly   261 SNAAASGAGGGGGGGGGNGNGGAAGS--------------------------------------- 286
            |..:.:..|.......|.|.....|:                                       
 Frog   199 STPSRNRGGVISPAFPGRGASATRGAPITRGTISTVARGIPTPRAKAAPTTPGYRLPPPLTIETY 263

  Fly   287 ---GSNNGNG---NQRS----GGNYRQKFQQQSHYRHNEETVYFRSHNNAYHQPKPYVPAAQRGN 341
               |.::|.|   :::|    ..||..:.|..|.|...|......|:|: |.|        :..:
 Frog   264 DDYGYDDGFGEDYDEQSYDIYENNYNSQTQSVSEYYDYEHGTNEESYNH-YEQ--------EEWS 319

  Fly   342 AMHTTL------PPQAIVRASPPG 359
            ...:||      |.:|..|..|.|
 Frog   320 KSRSTLKAPLQRPARAGYREHPYG 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 68/121 (56%)
khdrbs2NP_001072215.1 Qua1 6..57 CDD:318503 13/51 (25%)
SF1_like-KH 61..180 CDD:239088 68/119 (57%)
Sam68-YY 263..317 CDD:318716 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102838540
eggNOG 1 0.900 E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3432
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T129092
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.760

Return to query results.
Submit another query.