DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and sf1

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_009301350.1 Gene:sf1 / 572785 ZFINID:ZDB-GENE-030131-2492 Length:663 Species:Danio rerio

Alignment Length:431 Identity:98/432 (23%)
Similarity:144/432 (33%) Gaps:143/432 (33%)


  Fly    61 NADGEKAQPAPAVQKYMQELMTERSRMENHFPLAVKLIDE----ALERVQLNGRIPTRDQYADVY 121
            |.:.....|.|......:.|.|...|...      ||.:|    ..|.|.||   |.....|| |
Zfish   147 NPEDRSPSPEPIYNSEGKRLNTREYRTRK------KLEEERHSLITEMVGLN---PEFKPPAD-Y 201

  Fly   122 QQRTIKLSQKVHVPIKDK--KFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKD---RAREE 181
            :....::|.||.:| :|:  :.|:||.|:||:||:|:.:::|...||:|.|:.|:|:   ..::.
Zfish   202 KPPATRVSDKVMIP-QDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDG 265

  Fly   182 ELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYL-----TPDKHDDIRQEQYRE 241
            ::....|.       |||..|:     |.....|..|:.:||..|     ||:..:|:|:.|.||
Zfish   266 QMLPGEDE-------PLHALVT-----ANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRE 318

  Fly   242 LM-------------------------------------------------------EDPEAAKK 251
            |.                                                       |.|::|:.
Zfish   319 LARLNGTLREDDNRILRPWQSTEPRSITNTTLCTKCGGAGHISSDCKFTSSFAPRPGEPPQSAQD 383

  Fly   252 LTLRQLQQQSNAAASGAGGGGGGGGGNGNGGAAGSGSNNGNGNQ---------RSGGNYRQKFQQ 307
            ......:..|..|..|.......|||:.|...:|...:..|.||         .||....:.|  
Zfish   384 KARMDKEYLSLMAELGEAPVPSSGGGHNNAPPSGPRPSGPNNNQPPPNRPPWMNSGPTDNRNF-- 446

  Fly   308 QSHYRHNEETVYFRSHNNAYHQPKPYV---PAAQRGNAMHTTLPPQAIVRASPPGMVVSAASFNG 369
              |..|....   ..||  :..|.|.:   |.....|.|     |...::..||.|         
Zfish   447 --HGMHQGPG---GPHN--FPPPMPNMGGPPMPPNPNGM-----PPPWMQPPPPPM--------- 490

  Fly   370 RNAGLGNAGGGGIMANSIVATTGGGIGGAVPPNMRYRPAAP 410
               |.|.|..|..|             |.:||.|...|..|
Zfish   491 ---GQGPAPPGHPM-------------GLLPPPMGMMPPPP 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 40/180 (22%)
sf1XP_009301350.1 SF1-HH 90..202 CDD:292892 17/65 (26%)
SF1_like-KH 209..327 CDD:239088 40/131 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.