DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and B0280.17

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001040836.2 Gene:B0280.17 / 4363051 WormBaseID:WBGene00044674 Length:260 Species:Caenorhabditis elegans


Alignment Length:214 Identity:50/214 - (23%)
Similarity:97/214 - (45%) Gaps:28/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GAGTGVVPTGVSGGTSNGEHENEHNANADGEKAQPAPAVQKYMQE---LMTE---RSRMENHFPL 93
            |.|:|..|....|           .|||..:::....:::..:::   |||.   ..|.:...|:
 Worm    61 GLGSGTPPPSFLG-----------RANAGKDESMDLSSLRNLLKDDPLLMTPPPGLQRRQTFSPM 114

  Fly    94 AVKLIDEALERVQLNGRIPTRDQYADVYQQRTIKLSQKVHVPIKDKKFNYVGKLLGPKGNSLRRL 158
            .:.||. .|:    ||.....::....::    |:.:....|......|.||:|:||:|.::|:|
 Worm   115 TLSLIG-GLK----NGCSENENKEEGKFE----KIDKVFFPPETANNTNPVGRLIGPRGMTIRQL 170

  Fly   159 QEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIR 223
            :::..||:.|.|:...||.|:||.||....  :.||..|:||.:|..:...||.:....::.::.
 Worm   171 EKDLGCKLFIRGKGCTKDDAKEERLRERVG--WEHLKEPIHVMISVRSDSEEAASEKLSSIKKML 233

  Fly   224 RYLTPDKHDDIRQEQYREL 242
            :........::::.|..:|
 Worm   234 QEFLEHTDSELKRSQLMQL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 31/114 (27%)
B0280.17NP_001040836.2 KH-I 141..260 CDD:381803 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.