DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and how

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster

Alignment Length:222 Identity:63/223 (28%)
Similarity:119/223 (53%) Gaps:31/223 (14%)


  Fly    65 EKAQPAPAVQKYMQELMTERSRM---ENHFPLAVKLIDEALERV-----QLNG------RIPTRD 115
            ::.|...::..|:.:|:.:|.::   .|.|....:|:||.:.||     |:||      .:|.. 
  Fly    67 QQQQSTQSIADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQINGVKKEPLTLPEP- 130

  Fly   116 QYADVYQQRTIKLSQKVHVPIKD-KKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAR 179
                  :...:.:::||:||::: ..||:||::|||:|.:.::|::||.|||::.|:.||:|:.:
  Fly   131 ------EGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKK 189

  Fly   180 EEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYLTP--DKHDDIRQEQYREL 242
            |:  .|.....:.||:..|||.::.......|..::|.|:||:::.|.|  :..|::::.|..||
  Fly   190 ED--ANRGKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMEL 252

  Fly   243 MEDPEAAKKLTLRQLQQQSNAAASGAG 269
                 |....|.|....:|.||.|..|
  Fly   253 -----AIINGTYRDTTAKSVAAFSCVG 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 40/118 (34%)
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 13/48 (27%)
SF1_like-KH 139..260 CDD:239088 42/128 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102862422
eggNOG 1 0.900 E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11208
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.